6V5V: Tubulin gamma-1 chain

Structure of gamma-tubulin in the native human gamma-tubulin ring complex. Determined by electron microscopy at 3.8 Å resolution. Released 1 Jan 2020.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,979
Mol. weight: 51.7 kDa
Ligands: GDP
Released: 1 Jan 2020

Explore 6V5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V5V contains 17 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain g: 17 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	11-28	18
β-strand	31	1	2
β-strand	37	1	2
β-strand	52-53	2	3
β-strand	61-62	2	3
β-strand	64-66	3	1
α-helix	73-79	7
α-helix	83-85	3
α-helix	104-113	10
α-helix	115-127	13
β-strand	132-138	7	1
β-strand	140	1	4
α-helix	145-160	16
β-strand	165	1	1
β-strand	168	1	1
β-strand	171	1	4
β-strand	172	1	5
α-helix	184-195	12
β-strand	203	1	6
β-strand	206	1	5
α-helix	207-213	7
α-helix	214-218	5
α-helix	225-239	15
α-helix	241-244	4
α-helix	253-260	8
β-strand	269	1	6
β-strand	270-273	4	7
α-helix	290-297	8
β-strand	303	1	7
β-strand	317-324	8	7
α-helix	333-343	11
β-strand	348	1	7
β-strand	356-360	5	7
β-strand	375-381	7	7
α-helix	382-384	3
α-helix	385-399	15
α-helix	420-438	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin gamma-1 chain	g	protein	451	Homo sapiens	P23258 (AlphaFold model)

Sequence of entity 1 (g), FASTA

>6V5V_1 Tubulin gamma-1 chain (chains g)
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

Asymmetric Molecular Architecture of the Human gamma-Tubulin Ring Complex. Wieczorek, M., Urnavicius, L., Ti, S.C. et al. Cell (2020) 180:165-175.e16. DOI 10.1016/j.cell.2019.12.007 · PubMed

Other PDB entries of the same protein (UniProt P23258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CB2 2.3 Å, Crystal structure of human gamma-tubulin bound to GDP
1Z5V 2.71 Å, Crystal structure of human gamma-tubulin bound to GTPgammaS
1Z5W 3.0 Å, Crystal Structure of gamma-tubulin bound to GTP
8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
8VA2 4.5 Å, Symmetry expanded map of 2 gamma-tubulins bound to 2 alpha tubulins in gamma tubulin…
9H9P 4.5 Å, Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and…
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…

Browse structure collections

About this viewer

MolViewer shows 6V5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.