6WWA: Human SHLD2-SHLD3-REV7 complex

Crystal structure of human SHLD2-SHLD3-REV7 complex. Determined by X-ray diffraction at 3.8 Å resolution. Released 3 Mar 2021.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,776
Mol. weight: 118.65 kDa
Released: 3 Mar 2021

Explore 6WWA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WWA contains 33 α-helices and 37 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	15-33	19
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	82-88	7	2
β-strand	94-103	10	2
α-helix	117-131	15
α-helix	133-136	4
α-helix	138-141	4
β-strand	145-151	7	2
β-strand	171-173	3	2
α-helix	176-179	4
α-helix	184	1
β-strand	185-193	9	2
β-strand	198-205	8	2

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	15-33	19
β-strand	42-47	6	7
β-strand	50-55	6	7
α-helix	58-76	19
β-strand	82-88	7	6
β-strand	94-101	8	6
α-helix	121-134	14
α-helix	138-141	4
β-strand	145-152	8	6
β-strand	200-205	6	6
β-strand	206	1	8

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	15-33	19
α-helix	39-41	3
β-strand	42-47	6	5
β-strand	50-55	6	5
α-helix	58-76	19
β-strand	82-88	7	6
β-strand	94-102	9	6
α-helix	121-134	14
α-helix	137-141	5
β-strand	145-151	7	6
β-strand	199-206	8	6

Chain D: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-47	6	3
β-strand	50-55	6	3
α-helix	58-77	20
β-strand	82-88	7	4
β-strand	94-103	10	4
α-helix	117-122	6
α-helix	124-131	8
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-151	7	4
α-helix	160-163	4
β-strand	171-173	3	4
α-helix	174-175	2
α-helix	176-178	3
β-strand	184-193	10	4
β-strand	198-206	9	4

Chain X: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	35-39	5	6
α-helix	50-58	9
β-strand	63	1	8
α-helix	65-69	5
β-strand	82-84	3	2
α-helix	87-89	3

Chain Y: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	35-38	4	6
α-helix	50-56	7
β-strand	63-64	2	6
α-helix	65-69	5
β-strand	82-84	3	4
α-helix	87-89	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A, B, C, D	protein	211	Homo sapiens	Q9UI95 (AlphaFold model)
Shieldin complex subunit 2,Shieldin complex subunit 3 chimera	X, Y	protein	99	Homo sapiens	Q6ZNX1 (AlphaFold model), Q86V20 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6WWA_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A, B, C, D)
STTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Sequence of entity 2 (X, Y), FASTA

>6WWA_2 Shieldin complex subunit 2,Shieldin complex subunit 3 chimera (chains X, Y)
MSQVHIFWGAPIAPLKGSGSGSGSGSGSGSGSTTEVILHYRPCESDPTQLPKIAEKAIQD
FPTRPLSRFIPWFPYDGSKLPLRPKRSPPASREEIMATL

Primary citation

Molecular mechanisms of assembly and TRIP13-mediated remodeling of the human Shieldin complex. Xie, W., Wang, S., Wang, J. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2024512118 · PubMed

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
6M7B 1.77 Å, Structure of REV7-R124A complexed with SHLD3(37-73)
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
5XPU 2.3 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal

Browse structure collections

About this viewer

MolViewer shows 6WWA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.