4P0P: Human Mus81-Eme1

Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 May 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 5
Atoms: 5,147
Mol. weight: 89.7 kDa
Ligands: MG
Released: 28 May 2014

Explore 4P0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P0P contains 30 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	261-262	2	1
β-strand	267-274	8	2
α-helix	287-293	7
β-strand	298-301	4	2
β-strand	308-314	7	2
β-strand	325-336	12	2
α-helix	337-346	10
α-helix	348-357	10
β-strand	363-369	7	2
α-helix	381-393	13
α-helix	397	1
β-strand	398-401	4	2
α-helix	405-422	18
β-strand	428-430	3	1
α-helix	448	1
α-helix	450	1
β-strand	452-453	2	1
β-strand	454-455	2	2
α-helix	456-462	7
β-strand	470	1	3
α-helix	471-479	9
β-strand	482	1	4
α-helix	487-496	10
α-helix	500-509	10
α-helix	513-517	5
β-strand	524-525	2	5
β-strand	530-531	2	5
α-helix	535-545	11

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	247-251	5
β-strand	252-256	5	6
α-helix	258-261	4
α-helix	266-275	10
β-strand	279-282	4	6
β-strand	290-295	6	6
α-helix	306	1
β-strand	307-308	2	6
α-helix	309	1
β-strand	311-317	7	6
α-helix	318-328	11
α-helix	343-354	12
β-strand	358-364	7	6
α-helix	405-418	14
β-strand	422-426	5	6
α-helix	429-455	27
α-helix	459-461	3
α-helix	466-468	3
β-strand	469	1	4
α-helix	470	1
α-helix	478-487	10
α-helix	494-503	10
α-helix	507-515	9
β-strand	531	1	7
β-strand	544	1	7
α-helix	547-558	12
β-strand	565	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crossover junction endonuclease MUS81	A	protein	306	Homo sapiens	Q96NY9 (AlphaFold model)
Crossover junction endonuclease EME1	B	protein	393	Homo sapiens	Q96AY2 (AlphaFold model)
DNA gaatgtgtgtctcaatc	E	DNA	17	synthetic construct
DNA ggattg	F	DNA	6	synthetic construct
DNA taaccagacacacatt	G	DNA	16	synthetic construct

Sequence of entity 1 (A), FASTA

>4P0P_1 Crossover junction endonuclease MUS81 (chains A)
SAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLHV
GDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERRV
YLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQG
HTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGV
SGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYC
SYGPLT

Sequence of entity 2 (B), FASTA

>4P0P_2 Crossover junction endonuclease EME1 (chains B)
GQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALV
TRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRA
GPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGK
ALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQL
HTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRG
LALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEG
VTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD

Sequence of entity 3 (E), FASTA

>4P0P_3 DNA GAATGTGTGTCTCAATC (chains E)
GAATGTGTGTCTCAATC

Sequence of entity 4 (F), FASTA

>4P0P_4 DNA GGATTG (chains F)
GGATTG

Sequence of entity 5 (G), FASTA

>4P0P_5 DNA TAACCAGACACACATT (chains G)
TAACCAGACACACATT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates. Gwon, G.H., Jo, A., Baek, K. et al. EMBO J (2014) 33:1061-1072. DOI 10.1002/embj.201487820 · PubMed

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex
4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 4P0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.