9F9M: MUS81-EME1 bound by compound 21

Crystal structure of MUS81-EME1 bound by compound 21. Determined by X-ray diffraction at 2.47 Å resolution. Released 19 Jun 2024.

Method: X-ray diffraction
Resolution: 2.47 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,941
Mol. weight: 141.34 kDa
Ligands: MG, A1IA4
Released: 19 Jun 2024

Explore 9F9M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9F9M contains 32 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	261-262	2	1
β-strand	267-274	8	2
α-helix	275-278	4
α-helix	288-293	6
β-strand	298-301	4	2
β-strand	308-314	7	2
β-strand	325-336	12	2
α-helix	337-346	10
α-helix	349-357	9
β-strand	363-369	7	2
α-helix	381-393	13
α-helix	397	1
β-strand	398-402	5	2
α-helix	405-423	19
β-strand	428-431	4	1
β-strand	452-454	3	1
β-strand	455	1	2
α-helix	456-460	5

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	253-256	4	3
α-helix	258-261	4
α-helix	266-275	10
β-strand	279-282	4	3
β-strand	290-294	5	3
β-strand	308	1	3
β-strand	311-317	7	3
α-helix	318-326	9
α-helix	343-354	12
β-strand	358-364	7	3
α-helix	405-418	14
β-strand	422-426	5	3
α-helix	429-445	17

Chain C: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	261-262	2	4
β-strand	267-274	8	5
α-helix	275-278	4
α-helix	286-293	8
β-strand	298-301	4	5
β-strand	308-314	7	5
β-strand	326	1	6
β-strand	327-336	10	5
α-helix	337-346	10
α-helix	349-357	9
β-strand	363-369	7	5
α-helix	381-393	13
α-helix	397	1
β-strand	398-402	5	5
α-helix	405-423	19
β-strand	428-429	2	4
β-strand	430-431	2	7
α-helix	448	1
α-helix	450	1
β-strand	453-454	2	7
β-strand	455	1	6
α-helix	456-460	5

Chain D: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	253-256	4	8
α-helix	258-262	5
α-helix	266-275	10
β-strand	279-282	4	8
β-strand	290-294	5	8
α-helix	307	1
β-strand	308	1	8
α-helix	309	1
β-strand	311-317	7	8
α-helix	318-326	9
α-helix	343-354	12
β-strand	358-364	7	8
α-helix	405-418	14
β-strand	422-426	5	8
α-helix	429-445	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crossover junction endonuclease MUS81	A, C	protein	308	Homo sapiens	Q96NY9 (AlphaFold model)
Crossover junction endonuclease EME1	B, D	protein	326	Homo sapiens	Q96AY2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>9F9M_1 Crossover junction endonuclease MUS81 (chains A, C)
GSSAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKL
HVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLER
RVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLY
QGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVR
GVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQL
YCSYGPLT

Sequence of entity 2 (B, D), FASTA

>9F9M_2 Crossover junction endonuclease EME1 (chains B, D)
GEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDRE
DWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALSLVIV
DQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTEAQAQ
IVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRR
QIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRR
IGPELSRRIYLQMTTLQPHLSLDSAD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
A1IA4	5-oxidanyl-4-oxidanylidene-1-(4-piperazin-1-ylphenyl)pyridine-3-carboxylic acid	C16 H17 N3 O4	2

Primary citation

Fragment-Based Discovery of Novel MUS81 Inhibitors. Collie, G.W., Borjesson, U., Chen, Y. et al. ACS Med Chem Lett (2024) 15:1151-1158. DOI 10.1021/acsmedchemlett.3c00453 · PubMed

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex
4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 9F9M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.