4P0S: Human Mus81-Eme1-3'flap DNA complex
human Mus81-Eme1-3'flap DNA complex. Determined by X-ray diffraction at 6.0 Å resolution. Released 28 May 2014.
- Method
- X-ray diffraction
- Resolution
- 6.0 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 20
- Atoms
- 20,884
- Mol. weight
- 371.14 kDa
- Released
- 28 May 2014
Explore 4P0S in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4P0S contains 124 α-helices and 86 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 15 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 261-262 | 2 | 1 |
| β-strand | 267-274 | 8 | 1 |
| α-helix | 287-293 | 7 | |
| β-strand | 298-301 | 4 | 1 |
| β-strand | 308-314 | 7 | 1 |
| β-strand | 325-335 | 11 | 1 |
| α-helix | 337-345 | 9 | |
| α-helix | 348-357 | 10 | |
| β-strand | 363-368 | 6 | 1 |
| α-helix | 369 | 1 | |
| α-helix | 381-393 | 13 | |
| α-helix | 397 | 1 | |
| β-strand | 398-401 | 4 | 1 |
| α-helix | 405-422 | 18 | |
| β-strand | 428-431 | 4 | 1 |
| α-helix | 448 | 1 | |
| α-helix | 450 | 1 | |
| β-strand | 452-455 | 4 | 1 |
| α-helix | 456-462 | 7 | |
| α-helix | 473-479 | 7 | |
| β-strand | 482 | 1 | 2 |
| α-helix | 487-496 | 10 | |
| α-helix | 500-509 | 10 | |
| α-helix | 513-517 | 5 | |
| β-strand | 524 | 1 | 3 |
| β-strand | 531 | 1 | 3 |
| α-helix | 535-545 | 11 | |
Chain B: 17 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 239-241 | 3 | |
| α-helix | 248-251 | 4 | |
| β-strand | 252-256 | 5 | 4 |
| α-helix | 258-261 | 4 | |
| α-helix | 266-274 | 9 | |
| β-strand | 280-282 | 3 | 4 |
| β-strand | 290-295 | 6 | 4 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 4 |
| α-helix | 309 | 1 | |
| β-strand | 311-317 | 7 | 4 |
| α-helix | 318-328 | 11 | |
| α-helix | 343-354 | 12 | |
| β-strand | 358-364 | 7 | 4 |
| α-helix | 405-418 | 14 | |
| β-strand | 422-426 | 5 | 4 |
| α-helix | 429-455 | 27 | |
| α-helix | 458-461 | 4 | |
| α-helix | 466-468 | 3 | |
| β-strand | 469 | 1 | 2 |
| α-helix | 470 | 1 | |
| α-helix | 478-487 | 10 | |
| α-helix | 494-503 | 10 | |
| α-helix | 507-515 | 9 | |
| β-strand | 531 | 1 | 5 |
| β-strand | 544 | 1 | 5 |
| α-helix | 547-558 | 12 | |
Chain C: 15 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 261-262 | 2 | 6 |
| β-strand | 267-274 | 8 | 6 |
| α-helix | 287-293 | 7 | |
| β-strand | 298-301 | 4 | 6 |
| β-strand | 308-314 | 7 | 6 |
| β-strand | 325-335 | 11 | 6 |
| α-helix | 337-345 | 9 | |
| α-helix | 348-357 | 10 | |
| β-strand | 363-368 | 6 | 6 |
| α-helix | 369 | 1 | |
| α-helix | 381-393 | 13 | |
| α-helix | 397 | 1 | |
| β-strand | 398-401 | 4 | 6 |
| α-helix | 405-422 | 18 | |
| β-strand | 428-431 | 4 | 6 |
| α-helix | 448 | 1 | |
| α-helix | 450 | 1 | |
| β-strand | 452-455 | 4 | 6 |
| α-helix | 456-461 | 6 | |
| α-helix | 473-479 | 7 | |
| β-strand | 482 | 1 | 7 |
| α-helix | 487-496 | 10 | |
| α-helix | 500-509 | 10 | |
| α-helix | 513-517 | 5 | |
| β-strand | 524 | 1 | 8 |
| β-strand | 531 | 1 | 8 |
| α-helix | 536-544 | 9 | |
Chain D: 16 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 248-251 | 4 | |
| β-strand | 252-256 | 5 | 9 |
| α-helix | 258-261 | 4 | |
| α-helix | 266-274 | 9 | |
| β-strand | 280-282 | 3 | 9 |
| β-strand | 290-295 | 6 | 9 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 9 |
| α-helix | 309 | 1 | |
| β-strand | 311-317 | 7 | 9 |
| α-helix | 318-328 | 11 | |
| α-helix | 343-354 | 12 | |
| β-strand | 358-364 | 7 | 9 |
| α-helix | 405-418 | 14 | |
| β-strand | 422-426 | 5 | 9 |
| α-helix | 429-455 | 27 | |
| α-helix | 458-460 | 3 | |
| α-helix | 466-468 | 3 | |
| β-strand | 469 | 1 | 7 |
| α-helix | 470 | 1 | |
| α-helix | 478-487 | 10 | |
| α-helix | 494-503 | 10 | |
| α-helix | 507-515 | 9 | |
| β-strand | 531 | 1 | 10 |
| β-strand | 544 | 1 | 10 |
| α-helix | 547-558 | 12 | |
Chain E: 15 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 261-262 | 2 | 11 |
| β-strand | 267-274 | 8 | 11 |
| α-helix | 287-293 | 7 | |
| β-strand | 298-301 | 4 | 11 |
| β-strand | 308-314 | 7 | 11 |
| β-strand | 325-335 | 11 | 11 |
| α-helix | 337-345 | 9 | |
| α-helix | 348-357 | 10 | |
| β-strand | 363-368 | 6 | 11 |
| α-helix | 369 | 1 | |
| α-helix | 381-393 | 13 | |
| α-helix | 397 | 1 | |
| β-strand | 398-401 | 4 | 11 |
| α-helix | 405-422 | 18 | |
| β-strand | 428-431 | 4 | 11 |
| α-helix | 448 | 1 | |
| α-helix | 450 | 1 | |
| β-strand | 452-455 | 4 | 11 |
| α-helix | 456-462 | 7 | |
| α-helix | 473-479 | 7 | |
| α-helix | 487-496 | 10 | |
| α-helix | 500-509 | 10 | |
| α-helix | 513-517 | 5 | |
| β-strand | 524-525 | 2 | 12 |
| β-strand | 530-531 | 2 | 12 |
| α-helix | 535-545 | 11 | |
Chain F: 15 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 248-251 | 4 | |
| β-strand | 252-256 | 5 | 13 |
| α-helix | 258-261 | 4 | |
| α-helix | 266-274 | 9 | |
| β-strand | 280-282 | 3 | 13 |
| β-strand | 290-295 | 6 | 13 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 13 |
| α-helix | 309 | 1 | |
| β-strand | 311-317 | 7 | 13 |
| α-helix | 318-328 | 11 | |
| α-helix | 343-354 | 12 | |
| β-strand | 358-364 | 7 | 13 |
| α-helix | 405-418 | 14 | |
| β-strand | 422-426 | 5 | 13 |
| α-helix | 429-455 | 27 | |
| α-helix | 458-460 | 3 | |
| α-helix | 466-470 | 5 | |
| α-helix | 478-487 | 10 | |
| α-helix | 494-503 | 10 | |
| α-helix | 507-515 | 9 | |
| β-strand | 531 | 1 | 14 |
| β-strand | 544 | 1 | 14 |
| α-helix | 547-558 | 12 | |
Chain G: 15 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 261-262 | 2 | 15 |
| β-strand | 267-274 | 8 | 15 |
| α-helix | 287-293 | 7 | |
| β-strand | 298-301 | 4 | 15 |
| β-strand | 308-314 | 7 | 15 |
| β-strand | 325-335 | 11 | 15 |
| α-helix | 337-346 | 10 | |
| α-helix | 348-357 | 10 | |
| β-strand | 363-368 | 6 | 15 |
| α-helix | 369 | 1 | |
| α-helix | 381-393 | 13 | |
| α-helix | 397 | 1 | |
| β-strand | 398-401 | 4 | 15 |
| α-helix | 405-422 | 18 | |
| β-strand | 428-431 | 4 | 15 |
| α-helix | 448 | 1 | |
| α-helix | 450 | 1 | |
| β-strand | 452-455 | 4 | 15 |
| α-helix | 456-461 | 6 | |
| α-helix | 473-479 | 7 | |
| β-strand | 482 | 1 | 16 |
| α-helix | 487-496 | 10 | |
| α-helix | 500-509 | 10 | |
| α-helix | 513-517 | 5 | |
| β-strand | 524 | 1 | 17 |
| β-strand | 531 | 1 | 17 |
| α-helix | 535-545 | 11 | |
Chain H: 16 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 248-251 | 4 | |
| β-strand | 252-256 | 5 | 18 |
| α-helix | 258-261 | 4 | |
| α-helix | 266-274 | 9 | |
| β-strand | 280-282 | 3 | 18 |
| β-strand | 290-295 | 6 | 18 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 18 |
| α-helix | 309 | 1 | |
| β-strand | 311-317 | 7 | 18 |
| α-helix | 318-328 | 11 | |
| α-helix | 343-354 | 12 | |
| β-strand | 358-364 | 7 | 18 |
| α-helix | 405-418 | 14 | |
| β-strand | 422-426 | 5 | 18 |
| α-helix | 429-455 | 27 | |
| α-helix | 458-461 | 4 | |
| α-helix | 466-468 | 3 | |
| β-strand | 469 | 1 | 16 |
| α-helix | 470 | 1 | |
| α-helix | 478-487 | 10 | |
| α-helix | 494-503 | 10 | |
| α-helix | 507-515 | 9 | |
| β-strand | 531 | 1 | 19 |
| β-strand | 544 | 1 | 19 |
| α-helix | 547-558 | 12 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Crossover junction endonuclease MUS81 | A, C, E, G | protein | 306 | Homo sapiens | Q96NY9 (AlphaFold model) |
| Crossover junction endonuclease EME1 | B, D, F, H | protein | 393 | Homo sapiens | Q96AY2 (AlphaFold model) |
| DNA gaatgtgtgtct | I, M, Q, U | DNA | 12 | synthetic construct | |
| DNA tagacacacattcgggacatgcag | J, N, R, V | DNA | 24 | synthetic construct | |
| DNA tctgcatgtcatt | L, P, T, X | DNA | 13 | synthetic construct | |
Sequence of entity 1 (A, C, E, G), FASTA
>4P0S_1 Crossover junction endonuclease MUS81 (chains A, C, E, G)
SAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLHV
GDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERRV
YLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQG
HTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGV
SGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYC
SYGPLT
Sequence of entity 2 (B, D, F, H), FASTA
>4P0S_2 Crossover junction endonuclease EME1 (chains B, D, F, H)
GQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALV
TRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRA
GPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGK
ALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQL
HTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRG
LALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEG
VTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD
Sequence of entity 3 (I, M, Q, U), FASTA
>4P0S_3 DNA GAATGTGTGTCT (chains I, M, Q, U)
GAATGTGTGTCT
Sequence of entity 4 (J, N, R, V), FASTA
>4P0S_4 DNA TAGACACACATTCGGGACATGCAG (chains J, N, R, V)
TAGACACACATTCGGGACATGCAG
Sequence of entity 5 (L, P, T, X), FASTA
>4P0S_5 DNA TCTGCATGTCATT (chains L, P, T, X)
TCTGCATGTCATT
Primary citation
Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates. Gwon, G.H., Jo, A., Baek, K. et al. EMBO J (2014) 33:1061-1072. DOI 10.1002/embj.201487820 · PubMed
Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
- 9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
- 9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
- 9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
- 9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
- 4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
- 9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
- 4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
- 9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
- 7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
- 2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
- 4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex
Browse structure collections
About this viewer
MolViewer shows 4P0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.