7F6L: Human MUS81-EME2 complex

Crystal structure of human MUS81-EME2 complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,305
Mol. weight: 75.24 kDa
Released: 2 Mar 2022

Explore 7F6L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F6L contains 26 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	261-262	2	1
β-strand	268-273	6	2
α-helix	287-293	7
β-strand	298-300	3	2
β-strand	308-313	6	2
β-strand	326-336	11	2
α-helix	337-345	9
α-helix	348-357	10
β-strand	364-369	6	2
α-helix	381-393	13
α-helix	397	1
β-strand	398-402	5	2
α-helix	405-422	18
β-strand	428-429	2	1
β-strand	430	1	3
β-strand	453	1	3
β-strand	454-455	2	2
α-helix	456-467	12
α-helix	468-469	2
β-strand	470	1	4
α-helix	471-479	9
β-strand	482	1	5
α-helix	487-496	10
α-helix	500-509	10
α-helix	513-517	5
α-helix	536-545	10
α-helix	549-550	2

Chain B: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	76-80	5	6
α-helix	82-86	5
α-helix	88-90	3
α-helix	91-97	7
β-strand	103-106	4	6
β-strand	114-119	6	6
β-strand	137	1	6
β-strand	141-145	5	6
α-helix	147-156	10
β-strand	178-183	6	6
α-helix	185-192	8
α-helix	216-230	15
β-strand	234-237	4	6
α-helix	240-264	25
β-strand	280	1	5
β-strand	283	1	7
β-strand	286	1	7
α-helix	289-298	10
α-helix	305-314	10
α-helix	319-326	8
α-helix	331-335	5
β-strand	342-343	2	8
β-strand	352-353	2	8
α-helix	356-366	11
β-strand	374	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crossover junction endonuclease MUS81	A	protein	306	Homo sapiens	Q96NY9 (AlphaFold model)
Probable crossover junction endonuclease EME2	B	protein	379	Homo sapiens	A4GXA9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F6L_1 Crossover junction endonuclease MUS81 (chains A)
SAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLHV
GDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERRV
YLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQG
HTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGV
SGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYC
SYGPLT

Sequence of entity 2 (B), FASTA

>7F6L_2 Probable crossover junction endonuclease EME2 (chains B)
MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARARDPAGERRAA
AEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRA
SPDPCPRSLPPEVWAAGEQELLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTARPHL
AVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEALVLLQLWANLDVLLVASW
QELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQF
SRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGRPRRVGPDLSR
RICLFLTTANPDLLLDLGS

Primary citation

Crystal structure of the human MUS81-EME2 complex. Hua, Z., Fang, Q., Zhang, D. et al. Structure (2022) 30:743-752.e3. DOI 10.1016/j.str.2022.02.015 · PubMed

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex
4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 7F6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.