2ZIX: Mus81-Eme1 complex

Crystal structure of the Mus81-Eme1 complex. Determined by X-ray diffraction at 3.5 Å resolution. Released 29 Apr 2008.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,154
Mol. weight: 72.05 kDa
Released: 29 Apr 2008

Explore 2ZIX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZIX contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	272	1	1
α-helix	292-294	3
β-strand	308	1	2
β-strand	309	1	1
β-strand	330-332	3	2
α-helix	341-344	4
α-helix	348-352	5
β-strand	362-365	4	2
β-strand	368	1	3
α-helix	381-393	13
β-strand	401	1	3
α-helix	405-408	4
α-helix	410-413	4
α-helix	414-418	5
α-helix	462-464	3
α-helix	474-477	4
α-helix	500-508	9
α-helix	513-515	3
α-helix	534-544	11

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	253	1	4
β-strand	254-256	3	5
β-strand	280-282	3	5
β-strand	294	1	4
β-strand	315-317	3	6
α-helix	320-323	4
β-strand	362-364	3	6
β-strand	472	1	7
β-strand	476	1	7
α-helix	481-484	4
α-helix	507-513	7
α-helix	551-554	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crossover junction endonuclease MUS81	A	protein	307	Homo sapiens	Q96NY9 (AlphaFold model)
Crossover junction endonuclease EME1	B	protein	341	Homo sapiens	Q96AY2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZIX_1 Crossover junction endonuclease MUS81 (chains A)
MSAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLH
VGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERR
VYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQ
GHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRG
VSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLY
CSYGPLT

Sequence of entity 2 (B), FASTA

>2ZIX_2 Crossover junction endonuclease EME1 (chains B)
MGSSHHHHHHSQDPNSEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPC
SVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTD
ITAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAE
EALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGV
KVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLAD
IQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD

Primary citation

Crystal structure of the Mus81-Eme1 complex. Chang, J.H., Kim, J.J., Choi, J.M. et al. Genes Dev (2008) 22:1093-1106. DOI 10.1101/gad.1618708 · PubMed

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex
4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 2ZIX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.