7DTV: Human Calcium-Sensing Receptor

Human Calcium-Sensing Receptor bound with L-Trp and calcium ions. Determined by electron microscopy at 3.5 Å resolution. Released 10 Mar 2021.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 11,276
Mol. weight: 251.48 kDa
Ligands: NAG, CA, TRP
Released: 10 Mar 2021

Explore 7DTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DTV contains 74 α-helices and 68 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 37 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-33	2	2
β-strand	36-38	3	1
β-strand	44	1	3
α-helix	54-55	2
α-helix	57-59	3
β-strand	60	1	3
α-helix	65-83	19
β-strand	93-94	2	2
β-strand	95-99	5	1
α-helix	104-114	11
α-helix	136-137	2
β-strand	138	1	2
β-strand	141	1	4
β-strand	142-143	2	1
α-helix	150-153	4
β-strand	164-166	3	4
α-helix	173-175	3
β-strand	183-185	3	4
α-helix	193-203	11
β-strand	209-214	6	5
α-helix	220-229	10
β-strand	237-243	7	5
α-helix	249-260	12
β-strand	266-270	5	5
α-helix	277-286	10
β-strand	292-295	4	5
α-helix	308-310	3
β-strand	325	1	6
α-helix	330-334	5
α-helix	348-356	9
α-helix	393-395	3
β-strand	414	1	6
α-helix	416-435	20
α-helix	437-438	2
α-helix	445-447	3
α-helix	457-465	9
β-strand	469-470	2	7
β-strand	476-477	2	7
β-strand	484	1	4
β-strand	489	1	8
β-strand	492-495	4	9
α-helix	496-497	2
β-strand	504-507	4	9
β-strand	509-511	3	8
β-strand	521-523	3	8
β-strand	530	1	10
β-strand	534	1	10
α-helix	537-539	3
α-helix	544-546	3
β-strand	550	1	11
β-strand	553-554	2	12
β-strand	563-564	2	12
β-strand	567	1	11
β-strand	589-590	2	13
β-strand	600-601	2	13
α-helix	614-636	23
α-helix	653-663	11
α-helix	664-666	3
α-helix	674-678	5
α-helix	682-690	9
α-helix	693-696	4
α-helix	728-730	3
α-helix	732-745	14
α-helix	771-779	9
α-helix	783-786	4
α-helix	788-791	4
α-helix	803-826	24
α-helix	831-834	4
α-helix	837-850	14
α-helix	853-857	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	1099	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7DTV_1 Extracellular calcium-sensing receptor (chains A, B)
MKTIIALSYIFCLVFADYKDDDDENLYFQGYGPDQRAQKKGDIILGGLFPIHFGVAAKDQ
DLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALE
ATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYAS
SSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREE
AEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNIT
GKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAK
EFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYI
DYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNF
TNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKIL
WSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDF
WSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRE
LSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAK
IPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGS
LMALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTY
GKFVSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATL
RRSNVSRKRSSSLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLT
LPQQQRSQQQPRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTR
HEPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGS
TVTENVVNSHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8
CA	Calcium ion	Ca	4
TRP	Tryptophan	C11 H12 N2 O2	2

Primary citation

Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan. Ling, S., Shi, P., Liu, S. et al. Cell Res (2021) 31:383-394. DOI 10.1038/s41422-021-00474-0 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor

Browse structure collections

About this viewer

MolViewer shows 7DTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.