7E6T: Extracellular calcium-sensing receptor

Structural insights into the activation of human calcium-sensing receptor. Determined by electron microscopy at 3.0 Å resolution. Released 22 Sept 2021.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 12,741
Mol. weight: 196.4 kDa
Ligands: PO4, CA, NAG, TCR
Released: 22 Sept 2021

Explore 7E6T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E6T contains 65 α-helices and 75 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	13
β-strand	32-38	7	13
β-strand	44	1	14
β-strand	60	1	14
α-helix	66-82	17
β-strand	93-99	7	13
α-helix	104-114	11
α-helix	116-122	7
β-strand	129-131	3	3
β-strand	138-142	5	13
α-helix	149-157	9
β-strand	164-166	3	13
α-helix	172-175	4
β-strand	183-185	3	13
β-strand	188	1	15
α-helix	191-203	13
β-strand	208-214	7	16
α-helix	220-232	13
β-strand	236-243	8	16
α-helix	249-260	12
β-strand	266-268	3	17
β-strand	269-270	2	16
α-helix	273-286	14
β-strand	292-294	3	17
α-helix	308-310	3
β-strand	318-321	4	17
β-strand	325	1	18
α-helix	331-334	4
β-strand	345	1	13
α-helix	348-356	9
β-strand	359	1	19
β-strand	394	1	19
β-strand	414	1	18
α-helix	416-435	20
α-helix	437	1
β-strand	438	1	20
β-strand	441	1	20
α-helix	445-447	3
α-helix	457-465	9
β-strand	468-470	3	21
β-strand	476-478	3	21
β-strand	485	1	15
β-strand	489-496	8	17
β-strand	503-511	9	17
β-strand	521-523	3	17
α-helix	525-527	3
β-strand	530	1	22
β-strand	534	1	22
α-helix	537-539	3
α-helix	544-546	3
β-strand	550-553	4	23
β-strand	564-567	4	23
β-strand	573	1	24
β-strand	583	1	24
β-strand	590-591	2	25
β-strand	598-599	2	25
β-strand	602-604	3	26
α-helix	611-626	16
α-helix	628-631	4
α-helix	653-663	11
α-helix	664-666	3
α-helix	685-706	22
α-helix	724-740	17
α-helix	741-745	5
β-strand	751	1	27
β-strand	760-762	3	26
β-strand	764	1	27
α-helix	770-795	26
α-helix	803-820	18
α-helix	822-826	5
α-helix	833-852	20
α-helix	854-858	5

Chain B: 34 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41	1	2
β-strand	63	1	2
α-helix	66-82	17
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-122	7
β-strand	129-131	3	3
β-strand	138-142	5	1
α-helix	143-144	2
α-helix	148-157	10
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	190-203	14
β-strand	208-214	7	4
α-helix	221-232	12
β-strand	236-243	8	4
α-helix	249-260	12
β-strand	266-270	5	4
α-helix	273-286	14
β-strand	292-294	3	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	4
α-helix	330-334	5
α-helix	348-356	9
β-strand	359	1	5
β-strand	394	1	5
α-helix	416-436	21
α-helix	437-438	2
α-helix	445-447	3
β-strand	451	1	6
β-strand	454	1	6
α-helix	457-465	9
β-strand	468-470	3	7
β-strand	476-478	3	7
β-strand	489-496	8	4
β-strand	503-511	9	4
β-strand	521-523	3	4
α-helix	525-527	3
β-strand	530	1	8
β-strand	534	1	8
α-helix	537-538	2
α-helix	544-546	3
β-strand	550-553	4	9
β-strand	564-567	4	9
β-strand	572-573	2	10
β-strand	579	1	9
α-helix	582	1
β-strand	583-584	2	10
α-helix	585-586	2
β-strand	589-591	3	11
β-strand	598-600	3	11
α-helix	611-631	21
α-helix	652-668	17
α-helix	681-689	9
α-helix	693-707	15
α-helix	726-728	3
α-helix	730-745	16
β-strand	749-751	3	12
β-strand	764-766	3	12
α-helix	771-791	21
α-helix	803-820	18
α-helix	822-826	5
α-helix	829-831	3
α-helix	833-852	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	862	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7E6T_1 Extracellular calcium-sensing receptor (chains A, B)
YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIE
EINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTI
AVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMAD
IIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVI
QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIG
FALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEE
SGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLP
GRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPE
DGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEP
TCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLF
AVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRL
RQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVIC
VIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYTCLLAAICFFFAFKSRKLPE
NFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIAILAASFGLLACIFFNKIYI
ILFKPSRNTIEAAADYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
CA	Calcium ion	Ca	6
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4
TCR	Cyclomethyltryptophan	C12 H12 N2 O2	2

Primary citation

Structural insights into the activation of human calcium-sensing receptor. Chen, X., Wang, L., Cui, Q. et al. Elife (2021) 10. DOI 10.7554/eLife.68578 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 7E6T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.