7LVS: The CBP TAZ1 Domain

The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide. Determined by X-ray diffraction at 2.02 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 2.02 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,253
Mol. weight: 19 kDa
Ligands: ZN
Released: 28 Jul 2021

Explore 7LVS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LVS contains 11 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	344-346	3
α-helix	347-373	27
α-helix	384-394	11
α-helix	400-402	3
α-helix	408-420	13
α-helix	430-433	4

Chain F: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
α-helix	13-14	2
α-helix	15-24	10
α-helix	38-44	7
α-helix	50-52	3
α-helix	57-64	8
β-strand	65	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone lysine acetyltransferase CREBBP	B	protein	100	Mus musculus	P45481 (AlphaFold model)
Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha	F	protein	67	Homo sapiens	Q16665 (AlphaFold model), Q99967 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7LVS_1 Histone lysine acetyltransferase CREBBP (chains B)
ATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQA
GKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKR

Sequence of entity 2 (F), FASTA

>7LVS_2 Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha (chains F)
GSHMSNVIDTDFIDEEVLMSLVIEMGLDRIKELPELTSYDCEVNAPIQGSRNLLQGEELL
RALDQVN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

The molecular basis of allostery in a facilitated dissociation process. Appling, F.D., Berlow, R.B., Stanfield, R.L. et al. Structure (2021) 29:1327-1338.e5. DOI 10.1016/j.str.2021.07.011 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…
1F81 Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp

Browse structure collections

About this viewer

MolViewer shows 7LVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.