7M3E: Extracellular calcium-sensing receptor

Asymmetric Activation of the Calcium Sensing Receptor Homodimer. Determined by electron microscopy at 3.2 Å resolution. Released 30 Jun 2021.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 13,091
Mol. weight: 207.48 kDa
Ligands: PO4, CA, TRP, NAG
Released: 30 Jun 2021

Explore 7M3E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M3E contains 70 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41	1	2
β-strand	44	1	3
α-helix	57-59	3
β-strand	60	1	3
β-strand	63	1	2
α-helix	65-83	19
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-123	8
β-strand	138-142	5	1
α-helix	149-157	9
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	191-203	13
β-strand	208-214	7	4
α-helix	219-232	14
β-strand	236-243	8	4
α-helix	249-259	11
β-strand	266-270	5	4
α-helix	273-286	14
β-strand	292-295	4	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	4
α-helix	330-334	5
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	5
α-helix	392-393	2
β-strand	394	1	5
α-helix	395	1
α-helix	401-403	3
α-helix	416-435	20
α-helix	437-438	2
α-helix	457-464	8
β-strand	468-470	3	6
β-strand	476-478	3	6
β-strand	489-496	8	4
β-strand	503-511	9	4
β-strand	521-523	3	4
α-helix	525-527	3
α-helix	544-546	3
β-strand	550-552	3	7
β-strand	565-567	3	7
α-helix	568-569	2
β-strand	572-573	2	8
α-helix	582	1
β-strand	583-584	2	8
α-helix	585-586	2
β-strand	589-591	3	9
β-strand	598-600	3	9
β-strand	602-604	3	10
α-helix	611-636	26
α-helix	641-645	5
α-helix	654-663	10
α-helix	674-696	23
α-helix	724-745	22
β-strand	749-753	5	10
β-strand	760-766	7	10
α-helix	771-792	22
α-helix	803-827	25
α-helix	836-850	15
α-helix	855-861	7
α-helix	863-865	3

Chain B: 35 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	11
β-strand	32-38	7	11
β-strand	41	1	12
β-strand	44	1	13
β-strand	60	1	13
β-strand	63	1	12
α-helix	65-82	18
β-strand	93-99	7	11
α-helix	104-114	11
α-helix	116-123	8
β-strand	138-142	5	11
α-helix	149-157	9
β-strand	164-166	3	11
α-helix	172-175	4
β-strand	183-185	3	11
α-helix	191-203	13
β-strand	208-214	7	14
α-helix	219-232	14
β-strand	236-243	8	14
α-helix	249-260	12
β-strand	266-270	5	14
α-helix	273-286	14
β-strand	292-295	4	14
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	14
α-helix	330-335	6
β-strand	345	1	11
α-helix	348-356	9
β-strand	359	1	15
α-helix	360-362	3
β-strand	394	1	15
α-helix	401-403	3
α-helix	417-435	19
α-helix	437-438	2
α-helix	457-465	9
β-strand	468-470	3	16
β-strand	476-478	3	16
β-strand	489-496	8	14
β-strand	503-511	9	14
β-strand	521-523	3	14
α-helix	525-527	3
β-strand	530	1	17
β-strand	533	1	17
α-helix	537-539	3
α-helix	544-546	3
β-strand	550-551	2	18
β-strand	566-567	2	18
β-strand	572-573	2	19
β-strand	583-584	2	19
α-helix	585-586	2
β-strand	589-591	3	20
α-helix	592	1
α-helix	593-595	3
β-strand	598-600	3	20
β-strand	602-604	3	21
α-helix	611-636	26
α-helix	641-645	5
α-helix	648-663	16
α-helix	675-678	4
α-helix	680-698	19
α-helix	726-745	20
β-strand	749-753	5	21
β-strand	760-766	7	21
α-helix	771-792	22
α-helix	803-825	23
α-helix	836-839	4
α-helix	841-861	21
α-helix	863-865	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	902	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7M3E_1 Extracellular calcium-sensing receptor (chains A, B)
MKTIIALSYIFCLVFADYKDDDDKAAAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLK
SRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATL
SFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSR
LLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEE
RDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKI
WLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFW
EETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYT
HLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNN
MGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSG
FSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSN
ENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSY
LLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPT
SFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMA
LGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKF
VSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRS
NV

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
CA	Calcium ion	Ca	4
TRP	Tryptophan	C11 H12 N2 O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	9
YP1	2-chloro-6-[(2R)-2-hydroxy-3-{[2-methyl-1-(naphthalen-2-yl)propan-2-yl]amino}pr…	C24 H25 Cl N2 O2	2

Primary citation

Asymmetric activation of the calcium-sensing receptor homodimer. Gao, Y., Robertson, M.J., Rahman, S.N. et al. Nature (2021) 595:455-459. DOI 10.1038/s41586-021-03691-0 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor

Browse structure collections

About this viewer

MolViewer shows 7M3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.