7XUV: RPA70N-RMI1 fusion

Crystal structure of RPA70N-RMI1 fusion. Determined by X-ray diffraction at 1.6 Å resolution. Released 14 Jun 2023.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,123
Mol. weight: 15.54 kDa
Released: 14 Jun 2023

Explore 7XUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XUV contains 7 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-16	8
β-strand	24-32	9	1
β-strand	42-47	6	1
β-strand	51-58	8	1
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	1
β-strand	92-103	12	1
α-helix	105-108	4
β-strand	116-117	2	1

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	244-250	7
α-helix	253-258	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 70 kDa DNA-binding subunit	A	protein	120	Homo sapiens	P27694 (AlphaFold model)
RecQ-mediated genome instability protein 1	B	protein	22	Homo sapiens	Q9H9A7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XUV_1 Replication protein A 70 kDa DNA-binding subunit (chains A)
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE

Sequence of entity 2 (B), FASTA

>7XUV_2 RecQ-mediated genome instability protein 1 (chains B)
SGSDEELLASLDENDELTANND

Primary citation

Structural characterization of human RPA70N association with DNA damage response proteins. Wu, Y., Fu, W., Zang, N. et al. Elife (2023) 12. DOI 10.7554/eLife.81639 · PubMed

Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O0A 1.2 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
5E7N 1.21 Å, Crystal Structure of RPA70N in complex with VU0085636
4IPC 1.22 Å, Structure of the N-terminal domain of RPA70, E7R mutant
4R4T 1.28 Å, Crystal Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)phenylthioamido…
5N8A 1.28 Å, Structure of RPA70N in complex with PrimPol (fragment 480-560)
4R4O 1.33 Å, Crystal structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamot…
4NB3 1.35 Å, Crystal structure of RPA70N in complex with a 3,4 dichlorophenylalanine ATRIP derived…
4R4Q 1.35 Å, Crystal structure of RPA70N in complex with 5-(3-((N-(4-(5-carboxyfuran-2-yl)benzyl)aceta…
4LUV 1.4 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
4R4C 1.4 Å, Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)meth…
4R4I 1.4 Å, Structure of RPA70N in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydrois…
8K00 1.4 Å, RPA70N-MRE11 fusion

Browse structure collections

About this viewer

MolViewer shows 7XUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.