7XV4: RPA70N-ATRIP fusion

Crystal structure of RPA70N-ATRIP fusion. Determined by X-ray diffraction at 1.6 Å resolution. Released 14 Jun 2023.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,129
Mol. weight: 15.11 kDa
Released: 14 Jun 2023

Explore 7XV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XV4 contains 7 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-14	6
β-strand	24-33	10	1
β-strand	41-47	7	1
β-strand	51-58	8	1
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	1
β-strand	92-103	12	1
α-helix	105-108	4
β-strand	116-117	2	1

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	54-56	3
α-helix	57-64	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 70 kDa DNA-binding subunit	A	protein	121	Homo sapiens	P27694 (AlphaFold model)
ATR-interacting protein	B	protein	17	Homo sapiens	Q8WXE1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XV4_1 Replication protein A 70 kDa DNA-binding subunit (chains A)
SMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLA
TQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYN
E

Sequence of entity 2 (B), FASTA

>7XV4_2 ATR-interacting protein (chains B)
GDFTADDLEELDTLASQ

Primary citation

Structural characterization of human RPA70N association with DNA damage response proteins. Wu, Y., Fu, W., Zang, N. et al. Elife (2023) 12. DOI 10.7554/eLife.81639 · PubMed

Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O0A 1.2 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
5E7N 1.21 Å, Crystal Structure of RPA70N in complex with VU0085636
4IPC 1.22 Å, Structure of the N-terminal domain of RPA70, E7R mutant
4R4T 1.28 Å, Crystal Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)phenylthioamido…
5N8A 1.28 Å, Structure of RPA70N in complex with PrimPol (fragment 480-560)
4R4O 1.33 Å, Crystal structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamot…
4NB3 1.35 Å, Crystal structure of RPA70N in complex with a 3,4 dichlorophenylalanine ATRIP derived…
4R4Q 1.35 Å, Crystal structure of RPA70N in complex with 5-(3-((N-(4-(5-carboxyfuran-2-yl)benzyl)aceta…
4LUV 1.4 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
4R4C 1.4 Å, Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)meth…
4R4I 1.4 Å, Structure of RPA70N in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydrois…
8K00 1.4 Å, RPA70N-MRE11 fusion

Browse structure collections

About this viewer

MolViewer shows 7XV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.