8A60: FhuA

Crystal structure of FhuA in complex with the superinfection exclusion lipoprotein Llp. Determined by X-ray diffraction at 3.37 Å resolution. Released 5 Oct 2022.

Method: X-ray diffraction
Resolution: 3.37 Å
Organisms: Escherichia coli K-12, Escherichia phage T5
Chains: 2
Atoms: 5,804
Mol. weight: 88.58 kDa
Released: 5 Oct 2022

Explore 8A60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A60 contains 9 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	43	1	1
β-strand	52-53	2	2
α-helix	55-61	7
β-strand	76-77	2	3
β-strand	91-92	2	3
α-helix	98-100	3
β-strand	104-106	3	2
β-strand	113-114	2	4
β-strand	117-118	2	4
α-helix	123-125	3
β-strand	126-131	6	2
β-strand	149-153	5	2
β-strand	161-169	9	5
β-strand	173-183	11	5
β-strand	190-202	13	5
β-strand	209-221	13	5
β-strand	227-240	14	5
β-strand	247	1	6
α-helix	249-253	5
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	327-330	4
α-helix	336-338	3
β-strand	341-352	12	5
β-strand	354-363	10	5
β-strand	366-367	2	5
β-strand	370-371	2	5
β-strand	374-392	19	5
β-strand	399-400	2	5
β-strand	420-442	23	5
β-strand	445-462	18	5
β-strand	468-484	17	5
β-strand	490-501	12	5
β-strand	507	1	7
β-strand	511	1	7
α-helix	513-515	3
β-strand	516-527	12	5
β-strand	534-545	12	5
β-strand	565-576	12	5
β-strand	582-595	14	5
α-helix	605-606	2
β-strand	610	1	8
β-strand	612-621	10	5
β-strand	630-639	10	5
β-strand	642-643	2	8
β-strand	651-652	2	8
α-helix	653-654	2
β-strand	655-665	11	5
β-strand	675-681	7	5
β-strand	689-694	6	6
β-strand	697-700	4	6
β-strand	705-713	9	5

Chain B: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
β-strand	20-26	7	1
β-strand	29-30	2	9
β-strand	33-35	3	9
β-strand	46-48	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferrichrome outer membrane transporter/phage receptor	A	protein	716	Escherichia coli K-12	P06971 (AlphaFold model)
Lytic conversion lipoprotein	B	protein	83	Escherichia phage T5	Q38162

Sequence of entity 1 (A), FASTA

>8A60_1 Ferrichrome outer membrane transporter/phage receptor (chains A)
SMAVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEM
ALHQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYND
AVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGF
DFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNE
PETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQ
NLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVD
TQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPA
NSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTW
RGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTG
AVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTD
TTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVV
DALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF

Sequence of entity 2 (B), FASTA

>8A60_2 Lytic conversion lipoprotein (chains B)
MKKLFLAMAVVLLSACSTFGPKDIKCEAYYMQDHVKYKANVFDRKGDMFLVSPIMAYGSF
WAPVSYFTEGNTCEGVFHHHHHH

Primary citation

Structural basis for host recognition and superinfection exclusion by bacteriophage T5. van den Berg, B., Silale, A., Basle, A. et al. Proc Natl Acad Sci U S A (2022) 119:e2211672119-e2211672119. DOI 10.1073/pnas.2211672119 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CU4 2.3 Å, FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25)
1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
2FCP 2.5 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli
1BY5 2.6 Å, Fhua from E. Coli, with its ligand ferrichrome
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1FI1 2.9 Å, FhuA in complex with lipopolysaccharide and rifamycin CGP4832
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
1QKC 3.1 Å, Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA

Browse structure collections

About this viewer

MolViewer shows 8A60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.