8JZV: RPA70N-ETAA1 fusion

RPA70N-ETAA1 fusion. Determined by X-ray diffraction at 1.5 Å resolution. Released 13 Sept 2023.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,160
Mol. weight: 16.03 kDa
Released: 13 Sept 2023

Explore 8JZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JZV contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-15	7
β-strand	24-33	10	1
β-strand	41-47	7	1
β-strand	51-58	8	1
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	1
β-strand	92-103	12	1
α-helix	105-108	4
β-strand	116-117	2	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	604-613	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 70 kDa DNA-binding subunit	A	protein	120	Homo sapiens	P27694 (AlphaFold model)
Ewing's tumor-associated antigen 1	B	protein	24	Homo sapiens	Q9NY74 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JZV_1 Replication protein A 70 kDa DNA-binding subunit (chains A)
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE

Sequence of entity 2 (B), FASTA

>8JZV_2 Ewing's tumor-associated antigen 1 (chains B)
TWEADDVDDDLLYQACDDIERLTQ

Primary citation

Structural characterization of human RPA70N association with DNA damage response proteins. Wu, Y., Fu, W., Zang, N. et al. Elife (2023) 12. DOI 10.7554/eLife.81639 · PubMed

Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O0A 1.2 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
5E7N 1.21 Å, Crystal Structure of RPA70N in complex with VU0085636
4IPC 1.22 Å, Structure of the N-terminal domain of RPA70, E7R mutant
4R4T 1.28 Å, Crystal Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)phenylthioamido…
5N8A 1.28 Å, Structure of RPA70N in complex with PrimPol (fragment 480-560)
4R4O 1.33 Å, Crystal structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamot…
4NB3 1.35 Å, Crystal structure of RPA70N in complex with a 3,4 dichlorophenylalanine ATRIP derived…
4R4Q 1.35 Å, Crystal structure of RPA70N in complex with 5-(3-((N-(4-(5-carboxyfuran-2-yl)benzyl)aceta…
4LUV 1.4 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
4R4C 1.4 Å, Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)meth…
4R4I 1.4 Å, Structure of RPA70N in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydrois…
8K00 1.4 Å, RPA70N-MRE11 fusion

Browse structure collections

About this viewer

MolViewer shows 8JZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.