Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A. Determined by X-ray diffraction at 2.47 Å resolution. Released 3 Apr 2024.
Explore 8OG2 in 3D Show helices and sheets RCSB PDB PDBe
8OG2 contains 32 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1087-1102 | 16 | |
| α-helix | 1117-1120 | 4 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1144 | 10 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1195 | 23 | |
| β-strand | 1205 | 1 | 1 |
| α-helix | 1206-1208 | 3 | |
| α-helix | 1276 | 1 | |
| β-strand | 1277 | 1 | 1 |
| α-helix | 1278-1279 | 2 | |
| β-strand | 1280-1282 | 3 | 2 |
| β-strand | 1289-1291 | 3 | 2 |
| α-helix | 1292-1295 | 4 | |
| α-helix | 1310-1313 | 4 | |
| α-helix | 1317-1321 | 5 | |
| α-helix | 1330-1331 | 2 | |
| α-helix | 1333-1347 | 15 | |
| β-strand | 1357-1370 | 14 | 3 |
| α-helix | 1371-1372 | 2 | |
| α-helix | 1373-1375 | 3 | |
| α-helix | 1376-1380 | 5 | |
| β-strand | 1388-1402 | 15 | 3 |
| β-strand | 1405-1417 | 13 | 3 |
| α-helix | 1422 | 1 | |
| β-strand | 1428-1436 | 9 | 3 |
| α-helix | 1443-1445 | 3 | |
| α-helix | 1446-1464 | 19 | |
| β-strand | 1468-1472 | 5 | 3 |
| α-helix | 1475-1477 | 3 | |
| α-helix | 1491-1495 | 5 | |
| α-helix | 1496-1512 | 17 | |
| β-strand | 1518-1521 | 4 | 3 |
| α-helix | 1522-1526 | 5 | |
| α-helix | 1534-1536 | 3 | |
| α-helix | 1544-1552 | 9 | |
| α-helix | 1621-1627 | 7 | |
| α-helix | 1629-1631 | 3 | |
| β-strand | 1632-1636 | 5 | 3 |
| α-helix | 1659-1661 | 3 | |
| α-helix | 1664-1674 | 11 | |
| α-helix | 1681-1698 | 18 | |
| α-helix | 1703-1704 | 2 | |
| β-strand | 1705-1706 | 2 | 4 |
| β-strand | 1713-1714 | 2 | 4 |
| β-strand | 1718-1720 | 3 | 5 |
| β-strand | 1727 | 1 | 5 |
| β-strand | 1742-1744 | 3 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| histone acetyltransferase | A | protein | 640 | Mus musculus | P45481 (AlphaFold model) |
>8OG2_1 histone acetyltransferase (chains A) HHHHHHDYDIPTTENLYFQGAMGSSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQ PVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSR VYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNR YHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQI CVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPE AGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMH VQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWA CPPSEGDDYIFHCHPPDQKIPKPKRLQEWFKKMLDKAFAERIINDYKDIFKQANEDRLTS AKELPYFEGDFWPNVLEESIKESGGSGSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIV DPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNEC KHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
Water and common crystallization additives (SO4, NA) are not listed.
Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A. Mechaly, A.E., Zhang, W., Haouz, A. et al. To be published.
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8OG2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.