8PK6: INTS13 complex with ZNF655
INTS13 complex with ZNF655. Determined by X-ray diffraction at 3.21 Å resolution. Released 3 Jul 2024.
- Method
- X-ray diffraction
- Resolution
- 3.21 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 5,874
- Mol. weight
- 93.65 kDa
- Released
- 3 Jul 2024
Explore 8PK6 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8PK6 contains 36 α-helices and 22 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-8 | 3 | |
| β-strand | 9-14 | 6 | 1 |
| α-helix | 18-20 | 3 | |
| α-helix | 31-49 | 19 | |
| β-strand | 55-61 | 7 | 1 |
| β-strand | 65-67 | 3 | 1 |
| α-helix | 78-87 | 10 | |
| α-helix | 90-92 | 3 | |
| α-helix | 103-114 | 12 | |
| α-helix | 116-117 | 2 | |
| α-helix | 118-126 | 9 | |
| β-strand | 138-144 | 7 | 1 |
| α-helix | 149-172 | 24 | |
| β-strand | 182-188 | 7 | 1 |
| α-helix | 201-203 | 3 | |
| β-strand | 213-214 | 2 | 1 |
| α-helix | 222-233 | 12 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 96-109 | 14 | |
| α-helix | 111-114 | 4 | |
Chain C: 12 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-4 | 3 | |
| β-strand | 9-14 | 6 | 2 |
| α-helix | 18-20 | 3 | |
| α-helix | 31-49 | 19 | |
| β-strand | 55-60 | 6 | 2 |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 78-88 | 11 | |
| α-helix | 91-92 | 2 | |
| α-helix | 103-114 | 12 | |
| α-helix | 116-117 | 2 | |
| α-helix | 118-127 | 10 | |
| β-strand | 138-144 | 7 | 2 |
| α-helix | 149-166 | 18 | |
| α-helix | 167-171 | 5 | |
| β-strand | 182-190 | 9 | 2 |
| α-helix | 191 | 1 | |
| β-strand | 204 | 1 | 2 |
| β-strand | 210-218 | 9 | 2 |
| α-helix | 221-234 | 14 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 98-113 | 16 | |
Chain E: 9 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-4 | 3 | |
| α-helix | 6-8 | 3 | |
| β-strand | 9-14 | 6 | 3 |
| α-helix | 31-49 | 19 | |
| β-strand | 55-60 | 6 | 3 |
| β-strand | 66-67 | 2 | 3 |
| α-helix | 78-88 | 11 | |
| α-helix | 103-114 | 12 | |
| β-strand | 115 | 1 | 4 |
| α-helix | 116-117 | 2 | |
| α-helix | 118-126 | 9 | |
| β-strand | 138-143 | 6 | 3 |
| α-helix | 149-170 | 22 | |
| β-strand | 176 | 1 | 4 |
| β-strand | 182-189 | 8 | 3 |
| β-strand | 204 | 1 | 3 |
| β-strand | 210-217 | 8 | 3 |
| α-helix | 221-234 | 14 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 95-115 | 21 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Integrator complex subunit 13 | A, C, E | protein | 242 | Homo sapiens | Q9NVM9 (AlphaFold model) |
| Zinc finger protein 655 | B, D, F | protein | 30 | Homo sapiens | Q8N720 (AlphaFold model) |
Sequence of entity 1 (A, C, E), FASTA
>8PK6_1 Integrator complex subunit 13 (chains A, C, E)
GPHMLEMKIFSESHKTVFVVDHCPYMAESCRQHSKSLWTCSVESSMEYCRIMYDIFPFKK
LVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLC
KITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSD
HLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQH
FD
Sequence of entity 2 (B, D, F), FASTA
>8PK6_2 Zinc finger protein 655 (chains B, D, F)
GHMEDRLERLQEILRKFLYLEREFRQITIS
Primary citation
Basis of gene-specific transcription regulation by the Integrator complex. Sabath, K., Nabih, A., Arnold, C. et al. Mol Cell (2024) 84:2525. DOI 10.1016/j.molcel.2024.05.027 · PubMed
Other PDB entries of the same protein (UniProt Q9NVM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8PK5 2.5 Å, INTS13-INTS14 complex with ZNF609
- 6SN1 2.54 Å, Crystal structure of the human INTS13-INTS14 complex
- 8RC4 3.1 Å, Structure of Integrator-PP2A complex
- 9EOC 3.3 Å, Structure of the Integrator arm module containing INTS10/13/14 subunits
- 8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
- 9EP1 4.0 Å, Structure of the Integrator arm module containing INTS10/13/14/15 subunits (state 2)
- 9FA4 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 1)
- 9FA7 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3)
- 8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…
Browse structure collections
About this viewer
MolViewer shows 8PK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.