8WPG: Human calcium-sensing receptor

Human calcium-sensing receptor bound with cinacalcet in detergent. Determined by electron microscopy at 2.7 Å resolution. Released 22 Nov 2023.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 12,443
Mol. weight: 208.36 kDa
Ligands: YP4, PO4, CA, TRP
Released: 22 Nov 2023

Explore 8WPG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WPG contains 87 α-helices and 75 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 48 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	25-28	4	14
β-strand	32-38	7	14
β-strand	41	1	15
β-strand	44	1	16
α-helix	57-59	3
β-strand	60	1	16
β-strand	63	1	15
α-helix	65-83	19
β-strand	93-99	7	14
α-helix	104-114	11
α-helix	116-122	7
α-helix	136-137	2
β-strand	138-142	5	14
α-helix	147-157	11
β-strand	164-166	3	14
α-helix	172-175	4
β-strand	183-185	3	14
α-helix	191-203	13
β-strand	208-214	7	17
α-helix	219-232	14
β-strand	236-243	8	17
α-helix	249-261	13
β-strand	266-270	5	17
α-helix	273-286	14
α-helix	291	1
β-strand	292-295	4	17
α-helix	297-300	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-322	5	17
α-helix	323-324	2
β-strand	325	1	18
α-helix	330-335	6
β-strand	345	1	14
α-helix	348-356	9
β-strand	359	1	19
β-strand	394	1	19
α-helix	401-403	3
β-strand	414	1	18
α-helix	416-435	20
α-helix	437-438	2
α-helix	445-447	3
α-helix	452-454	3
α-helix	457-465	9
β-strand	468-470	3	20
β-strand	476-478	3	20
β-strand	489-496	8	17
β-strand	503-511	9	17
α-helix	516	1
β-strand	521-523	3	17
α-helix	525-527	3
β-strand	530	1	21
β-strand	534	1	21
α-helix	537-539	3
α-helix	544-546	3
β-strand	550-554	5	22
α-helix	555	1
β-strand	563-567	5	22
α-helix	568-569	2
β-strand	572-573	2	23
β-strand	579	1	22
α-helix	582	1
β-strand	583-584	2	23
α-helix	585-586	2
β-strand	589-591	3	24
β-strand	598-600	3	24
α-helix	601	1
β-strand	602-604	3	25
α-helix	611-636	26
α-helix	641-645	5
α-helix	648-664	17
α-helix	665-667	3
α-helix	674-678	5
α-helix	681-699	19
α-helix	725-745	21
β-strand	751-753	3	25
β-strand	760-764	5	25
α-helix	770-793	24
α-helix	794-796	3
α-helix	804-819	16
α-helix	822-825	4
α-helix	832-849	18
α-helix	850-854	5
α-helix	855-857	3
α-helix	858-862	5

Chain B: 39 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41	1	2
β-strand	44	1	3
α-helix	56-59	4
β-strand	60	1	3
β-strand	63	1	2
α-helix	65-83	19
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-123	8
α-helix	136-137	2
β-strand	138-142	5	1
α-helix	147-157	11
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	191-203	13
β-strand	208-214	7	4
α-helix	219-232	14
α-helix	235	1
β-strand	236-243	8	4
α-helix	249-260	12
β-strand	266-270	5	4
α-helix	273-286	14
β-strand	292-295	4	4
α-helix	297-300	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	4
β-strand	325	1	5
α-helix	330-335	6
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	6
β-strand	394	1	6
β-strand	414	1	5
α-helix	416-435	20
α-helix	437-438	2
α-helix	452-454	3
α-helix	457-465	9
β-strand	468-470	3	7
β-strand	476-478	3	7
β-strand	489-496	8	4
β-strand	503-511	9	4
α-helix	516	1
β-strand	521-523	3	4
α-helix	525-527	3
β-strand	530	1	8
β-strand	534	1	8
α-helix	537-539	3
β-strand	550	1	9
β-strand	553-554	2	10
α-helix	555	1
β-strand	563-564	2	10
α-helix	566	1
β-strand	567	1	9
α-helix	568-569	2
β-strand	573	1	11
β-strand	583	1	11
β-strand	589-591	3	12
β-strand	598-600	3	12
β-strand	602-604	3	13
α-helix	613-636	24
α-helix	650-664	15
α-helix	665-667	3
α-helix	674-677	4
α-helix	680-698	19
α-helix	723-745	23
β-strand	752-753	2	13
β-strand	760-763	4	13
α-helix	770-790	21
α-helix	803-819	17
α-helix	822-827	6
α-helix	831-833	3
α-helix	835-852	18
α-helix	854-857	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	903	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8WPG_1 Extracellular calcium-sensing receptor (chains A, B)
MKTIIALSYIFCLVFADYKDDDDENLYFQGYGPDQRAQKKGDIILGGLFPIHFGVAAKDQ
DLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALE
ATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYAS
SSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREE
AEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNIT
GKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAK
EFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYI
DYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNF
TNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKIL
WSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDF
WSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRE
LSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAK
IPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGS
LMALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTY
GKFVSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATL
RRS

Ligands and cofactors

ID	Name	Formula	Copies
YP4	N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine	C22 H22 F3 N	2
PO4	Phosphate ion	O4 P	2
CA	Calcium ion	Ca	4
TRP	Tryptophan	C11 H12 N2 O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Structural insights into asymmetric activation of the calcium-sensing receptor-G q complex. Ling, S., Meng, X., Zhang, Y. et al. Cell Res (2024) 34:169-172. DOI 10.1038/s41422-023-00892-2 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 8WPG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.