8ZYT: Neurotensin receptor 1

Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 3). Determined by electron microscopy at 2.65 Å resolution. Released 9 Apr 2025.

Method: Electron microscopy
Resolution: 2.65 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 5
Atoms: 7,930
Mol. weight: 162.5 kDa
Ligands: PIO, SRW
Released: 9 Apr 2025

Explore 8ZYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZYT contains 37 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	17-21	5	1
β-strand	25-27	3	2
β-strand	28	1	3
β-strand	33	1	3
α-helix	34-35	2
β-strand	37-42	6	1
α-helix	44-47	4
β-strand	51-61	11	4
β-strand	77-84	8	4
α-helix	94-97	4
α-helix	98-107	10
β-strand	111-115	5	1
β-strand	126-128	3	4
α-helix	129-131	3
α-helix	138-139	2
β-strand	140-150	11	4
β-strand	162-167	6	4
β-strand	168-170	3	2
α-helix	179-181	3
β-strand	185-187	3	5
β-strand	196-198	3	5
β-strand	206-208	3	6
β-strand	213-221	9	5
β-strand	227-241	15	7
β-strand	245-257	13	7
β-strand	261	1	7
β-strand	265-273	9	5
β-strand	284	1	8
β-strand	287-289	3	4
α-helix	290-291	2
β-strand	299	1	4
α-helix	300-302	3
β-strand	316-328	13	7
β-strand	340-348	9	7
β-strand	349-351	3	6
α-helix	352-354	3
β-strand	364	1	9

Chain D: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	10
β-strand	35	1	11
β-strand	42-48	7	10
β-strand	55-62	8	12
β-strand	68-74	7	12
β-strand	81-83	3	12
β-strand	92-96	5	10
β-strand	101-105	5	10
α-helix	111-113	3
β-strand	115-123	9	12
β-strand	132-133	2	12
β-strand	137-139	3	12
β-strand	141	1	11
α-helix	144-146	3
β-strand	150-154	5	13
β-strand	166-175	10	13
α-helix	179-180	2
β-strand	181-184	4	14
α-helix	185-187	3
β-strand	193-195	3	13
α-helix	196-198	3
β-strand	199-200	2	13
β-strand	206-214	9	13
α-helix	216-218	3
β-strand	224-229	6	14
β-strand	230	1	15
β-strand	235	1	15
β-strand	239-241	3	14

Chain Q: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	25-27	3	16
β-strand	31-34	4	17
β-strand	40-46	7	16
β-strand	54-59	6	17
β-strand	66-70	5	17
β-strand	74-75	2	17
α-helix	76	1
β-strand	83-87	5	16
β-strand	91-96	6	16
α-helix	101-103	3
β-strand	106-111	6	17
β-strand	114	1	9
β-strand	118-119	2	17
β-strand	123-127	5	17
α-helix	128	1
β-strand	135-139	5	18
α-helix	140-142	3
α-helix	143-147	5
β-strand	151-160	10	18
β-strand	167-168	2	19
β-strand	180-184	5	18
β-strand	194-202	9	18
α-helix	206-209	4
β-strand	212-217	6	19
β-strand	226-231	6	19

Chain R: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	60-89	30
β-strand	93	1	8
β-strand	95-96	2	7
α-helix	101-118	18
α-helix	120-123	4
α-helix	124-129	6
α-helix	139-171	33
α-helix	173-178	6
α-helix	182-198	17
α-helix	201-206	6
β-strand	209-210	2	20
β-strand	223-224	2	20
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-266	20
α-helix	302-304	3
α-helix	305-325	21
α-helix	336-367	32
α-helix	370-377	8
β-strand	408-411	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	402	Homo sapiens	P49407 (AlphaFold model)
Fab30 heavy chain	D	protein	260	Homo sapiens
Fab30 light chain	Q	protein	235	Homo sapiens
Soluble cytochrome b562,Neurotensin receptor type 1	R	protein	557	Escherichia coli, Homo sapiens	P30989 (AlphaFold model)
neurotensin peptide 8-13	L	protein	6	Homo sapiens

Sequence of entity 1 (B), FASTA

>8ZYT_1 Beta-arrestin-1 (chains B)
MGSHHHHHHHHGSLEVLFQGPGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV
VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK
RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHV
TNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLAS
SDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTN

Sequence of entity 2 (D), FASTA

>8ZYT_2 Fab30 heavy chain (chains D)
MVSAIVLYVLLAAAAHSAFAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWV
RQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCA
RSRQFWYSGLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTAAAHHHHHHHH

Sequence of entity 3 (Q), FASTA

>8ZYT_3 Fab30 light chain (chains Q)
MVSAIVLYVLLAAAAHSAFASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQK
PGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (R), FASTA

>8ZYT_4 Soluble cytochrome b562,Neurotensin receptor type 1 (chains R)
MKTIIALSYIFCLVFAGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK
ATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYI
QKYLASGSLEVLFQGPMRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASE
RVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYH
LGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSV
ERYLALCHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVC
TPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHS
TFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHY
FYMVTNALFYVSSTINPILYNLVSANFRHIFIATLACLCPVWRRRRKRPCFNAFSRKCDS
VSSNHTLSSNATRETLY

Sequence of entity 5 (L), FASTA

>8ZYT_5 neurotensin peptide 8-13 (chains L)
RRPYIL

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1
SRW	2-[{2-(1-fluorocyclopropyl)-4-[4-(2-methoxyphenyl)piperidin-1-yl]quinazolin-6-y…	C26 H31 F N4 O2	1

Primary citation

Molecular mechanism of the arrestin-biased agonism of neurotensin receptor 1 by an intracellular allosteric modulator. Sun, D., Li, X., Yuan, Q. et al. Cell Res (2025) 35:284-295. DOI 10.1038/s41422-025-01095-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 8ZYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.