8ZYU: Neurotensin receptor 1

Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 1). Determined by electron microscopy at 2.65 Å resolution. Released 16 Apr 2025.

Method: Electron microscopy
Resolution: 2.65 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 5
Atoms: 8,447
Mol. weight: 162.5 kDa
Ligands: PIO, SRW
Released: 16 Apr 2025

Explore 8ZYU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZYU contains 33 α-helices and 73 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 11 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	18-21	4	1
β-strand	25-27	3	2
β-strand	28	1	3
β-strand	33	1	3
α-helix	34-35	2
β-strand	36-41	6	1
α-helix	44-47	4
β-strand	51-64	14	4
β-strand	73-84	12	4
α-helix	94-97	4
α-helix	98-107	10
β-strand	111-116	6	1
α-helix	122-124	3
β-strand	126-128	3	4
α-helix	129-131	3
α-helix	137-139	3
β-strand	140-150	11	4
β-strand	162-167	6	4
β-strand	168-170	3	2
α-helix	179-181	3
β-strand	182-187	6	5
β-strand	196-202	7	5
β-strand	206-207	2	6
β-strand	213-221	9	5
β-strand	227-241	15	7
β-strand	245-257	13	7
β-strand	261	1	7
β-strand	265-273	9	5
β-strand	287-289	3	4
α-helix	290-291	2
β-strand	299	1	4
α-helix	300-304	5
β-strand	316-329	14	7
β-strand	339-348	10	7
β-strand	349-350	2	6
α-helix	352-354	3

Chain D: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	8
β-strand	34-35	2	9
β-strand	41-48	8	8
β-strand	55-62	8	10
β-strand	68-74	7	10
β-strand	81-83	3	10
β-strand	91-96	6	8
β-strand	101-106	6	8
α-helix	111-113	3
β-strand	115-123	9	10
β-strand	132-133	2	10
β-strand	137-139	3	10
β-strand	140-141	2	9
β-strand	150-154	5	11
β-strand	165-175	11	11
α-helix	179-180	2
β-strand	181-184	4	12
α-helix	185-187	3
β-strand	194-195	2	11
β-strand	199-200	2	11
β-strand	206-215	10	11
α-helix	216-218	3
β-strand	224-230	7	12
β-strand	235-241	7	12

Chain Q: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	25-27	3	13
β-strand	31-33	3	14
β-strand	40-46	7	13
β-strand	54-59	6	14
β-strand	66-70	5	14
β-strand	74-75	2	14
α-helix	76	1
β-strand	83-87	5	13
β-strand	91-96	6	13
α-helix	101-103	3
β-strand	106-111	6	14
β-strand	118-119	2	14
β-strand	123-126	4	14
β-strand	136-139	4	15
α-helix	140-142	3
α-helix	143-148	6
β-strand	150-160	11	15
β-strand	167-168	2	16
β-strand	171	1	17
β-strand	174	1	17
β-strand	181-184	4	15
β-strand	194-203	10	15
α-helix	204-209	6
β-strand	212-217	6	16
β-strand	226-231	6	16

Chain R: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	60-89	30
β-strand	95-96	2	7
α-helix	101-123	23
α-helix	124-128	5
α-helix	138-171	34
α-helix	173-179	7
α-helix	182-200	19
α-helix	202-206	5
β-strand	207-210	4	18
β-strand	223-226	4	18
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-266	20
β-strand	286-291	6	4
β-strand	294-298	5	4
α-helix	301-325	25
α-helix	336-367	32
β-strand	368	1	4
α-helix	369-381	13
β-strand	408-411	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	402	Homo sapiens	P49407 (AlphaFold model)
Fab30 heavy chain	D	protein	260	Homo sapiens
neurotensin peptide 8-13	L	protein	6	Homo sapiens
Fab30 light chain	Q	protein	235	Homo sapiens
Soluble cytochrome b562,Neurotensin receptor type 1	R	protein	557	Escherichia coli, Homo sapiens	P30989 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8ZYU_1 Beta-arrestin-1 (chains B)
MGSHHHHHHHHGSLEVLFQGPGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV
VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK
RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHV
TNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLAS
SDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTN

Sequence of entity 2 (D), FASTA

>8ZYU_2 Fab30 heavy chain (chains D)
MVSAIVLYVLLAAAAHSAFAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWV
RQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCA
RSRQFWYSGLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTAAAHHHHHHHH

Sequence of entity 3 (L), FASTA

>8ZYU_3 neurotensin peptide 8-13 (chains L)
RRPYIL

Sequence of entity 4 (Q), FASTA

>8ZYU_4 Fab30 light chain (chains Q)
MVSAIVLYVLLAAAAHSAFASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQK
PGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (R), FASTA

>8ZYU_5 Soluble cytochrome b562,Neurotensin receptor type 1 (chains R)
MKTIIALSYIFCLVFAGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK
ATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYI
QKYLASGSLEVLFQGPMRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASE
RVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYH
LGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSV
ERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVC
TPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHS
TFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHY
FYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPCFNAFSRKCDS
VSSNHTLSSNATRETLY

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1
SRW	2-[{2-(1-fluorocyclopropyl)-4-[4-(2-methoxyphenyl)piperidin-1-yl]quinazolin-6-y…	C26 H31 F N4 O2	1

Primary citation

Molecular mechanism of the arrestin-biased agonism of neurotensin receptor 1 by an intracellular allosteric modulator. Sun, D., Li, X., Yuan, Q. et al. Cell Res (2025) 35:284-295. DOI 10.1038/s41422-025-01095-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 8ZYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.