9BZ0: STK19-containing TC-NER complex

Structure of an STK19-containing TC-NER complex. Determined by electron microscopy at 1.9 Å resolution. Released 25 Dec 2024.

Method: Electron microscopy
Resolution: 1.9 Å
Organisms: Sus scrofa, Homo sapiens, synthetic construct
Chains: 22
Atoms: 54,687
Mol. weight: 1058.1 kDa
Ligands: ZN, MG
Released: 25 Dec 2024

Explore 9BZ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BZ0 contains 301 α-helices and 407 β-strands across 19 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 3 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	15-27	13
β-strand	30-32	3	77
β-strand	36-38	3	78
β-strand	46-51	6	79
β-strand	58-63	6	79
β-strand	68-72	5	79
β-strand	82-84	3	78
β-strand	86-90	5	79
β-strand	102-107	6	80
β-strand	111	1	81
β-strand	114-119	6	80
β-strand	123-128	6	80
β-strand	133-139	7	80
β-strand	144-149	6	82
β-strand	158-163	6	82
β-strand	168-172	5	82
β-strand	180-182	3	82
β-strand	189-194	6	83
β-strand	201-206	6	83
β-strand	211-215	5	83
β-strand	224-225	2	83
β-strand	248-253	6	84
β-strand	259-264	6	84
β-strand	268-273	6	84
β-strand	279	1	84
β-strand	298-299	2	85
β-strand	307-312	6	85
β-strand	315-320	6	85
β-strand	326-330	5	85
β-strand	337-343	7	77
β-strand	348-353	6	77
β-strand	358-363	6	77
α-helix	383-385	3

Chain A: 81 helices, 75 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	28-34	7
β-strand	43	1	4
β-strand	47-48	2	5
β-strand	51-52	2	5
α-helix	53	1
β-strand	56	1	4
β-strand	86-95	10	6
α-helix	100-107	8
β-strand	110	1	7
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	192-194	3	9
β-strand	197-200	4	9
β-strand	214-215	2	9
α-helix	216-217	2
α-helix	218-227	10
α-helix	230-235	6
α-helix	245-248	4
β-strand	249-255	7	6
α-helix	258-260	3
β-strand	264-265	2	10
β-strand	271-272	2	10
α-helix	275-293	19
α-helix	300-318	19
α-helix	326-328	3
β-strand	329	1	11
α-helix	331-333	3
α-helix	334	1
β-strand	335	1	11
α-helix	336-338	3
α-helix	339-343	5
α-helix	349-353	5
β-strand	357-359	3	12
β-strand	362-369	8	13
β-strand	377-381	5	13
α-helix	382-387	6
β-strand	389-393	5	14
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	14
β-strand	426-428	3	14
β-strand	445-449	5	14
α-helix	450	1
β-strand	455-459	5	13
α-helix	466-468	3
β-strand	469-477	9	13
β-strand	482-484	3	13
α-helix	489-492	4
β-strand	500-504	5	13
α-helix	509-518	10
β-strand	520	1	13
α-helix	521-524	4
β-strand	526-527	2	15
β-strand	532-533	2	15
α-helix	539-548	10
β-strand	554-555	2	16
α-helix	557-563	7
α-helix	573-574	2
β-strand	575	1	17
α-helix	576-577	2
β-strand	579	1	18
β-strand	585	1	18
β-strand	586-587	2	16
α-helix	588-595	8
β-strand	602-605	4	19
β-strand	627-631	5	19
β-strand	634-637	4	19
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
α-helix	689-692	4
α-helix	693-695	3
α-helix	696-721	26
α-helix	725-728	4
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	20
β-strand	793	1	21
β-strand	796	1	21
α-helix	798-799	2
β-strand	802	1	22
β-strand	805	1	22
α-helix	811	1
β-strand	822-823	2	20
α-helix	833-868	36
β-strand	872-873	2	23
β-strand	879-880	2	23
β-strand	886-888	3	23
β-strand	896	1	24
α-helix	898-900	3
β-strand	902-905	4	25
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	26
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	25
α-helix	983-993	11
β-strand	1002	1	26
α-helix	1006-1017	12
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1077	16
β-strand	1080	1	24
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1121-1129	9
β-strand	1139-1142	4	27
β-strand	1143	1	28
α-helix	1145-1148	4
α-helix	1151-1161	11
β-strand	1164-1165	2	29
α-helix	1166-1169	4
β-strand	1170-1177	8	30
α-helix	1181-1183	3
α-helix	1187-1189	3
α-helix	1190-1197	8
α-helix	1204-1206	3
β-strand	1207	1	31
β-strand	1210-1216	7	30
α-helix	1218-1222	5
α-helix	1228-1239	12
α-helix	1240-1242	3
β-strand	1243-1247	5	30
β-strand	1255-1261	7	30
β-strand	1262	1	31
α-helix	1281-1295	15
β-strand	1297-1299	3	29
β-strand	1306-1310	5	27
β-strand	1319-1322	4	32
β-strand	1328-1331	4	32
β-strand	1335-1339	5	27
α-helix	1343-1347	5
β-strand	1352	1	28
β-strand	1358-1359	2	27
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1406	12
α-helix	1416-1419	4
α-helix	1426-1430	5
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1462-1464	3
α-helix	1467-1469	3
β-strand	1471-1475	5	33

Chain b: 38 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	459-475	17
β-strand	491-492	2	86
β-strand	498-499	2	86
α-helix	501-504	4
α-helix	509-524	16
β-strand	528-530	3	87
α-helix	532-533	2
α-helix	538-552	15
β-strand	555	1	88
β-strand	564	1	88
β-strand	569-572	4	87
α-helix	575-577	3
α-helix	578-588	11
β-strand	594-597	4	87
α-helix	607-616	10
β-strand	620-623	4	87
α-helix	625-630	6
α-helix	632-636	5
β-strand	642-646	5	87
α-helix	648-651	4
α-helix	657-662	6
β-strand	670-673	4	87
α-helix	682-692	11
α-helix	700-703	4
α-helix	704-708	5
α-helix	709-712	4
α-helix	721-738	18
α-helix	739-741	3
β-strand	742-743	2	87
α-helix	747-749	3
α-helix	756-758	3
β-strand	759-766	8	89
α-helix	767-769	3
α-helix	770-780	11
α-helix	783-789	7
α-helix	796-807	12
α-helix	809-813	5
α-helix	817-818	2
α-helix	824-826	3
α-helix	835-837	3
α-helix	839-854	16
β-strand	858-862	5	89
α-helix	865-877	13
β-strand	882-885	4	89
α-helix	891-903	13
β-strand	909-913	5	89
β-strand	928-931	4	89
α-helix	938-945	8
β-strand	957-964	8	89
α-helix	968-987	20
α-helix	998-1001	4
α-helix	1017-1021	5
α-helix	1247-1257	11
β-strand	1262-1267	6	89
α-helix	1268-1271	4
β-strand	1335	1	81
α-helix	1386-1397	12

Chain B: 61 helices, 79 β-strands

Element	Residues	Length	Sheet
α-helix	19-37	19
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	65-68	4	34
β-strand	83-93	11	34
β-strand	98-99	2	35
β-strand	105-106	2	35
α-helix	110-116	7
β-strand	121-133	13	34
β-strand	140-153	14	34
α-helix	168-173	6
β-strand	185-187	3	36
β-strand	190-194	5	36
α-helix	195	1
β-strand	196-200	5	37
α-helix	201	1
β-strand	205-208	4	38
β-strand	215-223	9	38
β-strand	233-240	8	38
β-strand	256-259	4	38
β-strand	267-268	2	38
α-helix	269-275	7
α-helix	281-285	5
α-helix	295-307	13
α-helix	308-310	3
α-helix	314-322	9
α-helix	332-341	10
α-helix	342-346	5
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	37
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	39
α-helix	456-458	3
β-strand	463	1	39
α-helix	464	1
β-strand	467-469	3	36
α-helix	470-471	2
α-helix	475-481	7
β-strand	484-486	3	37
α-helix	497-499	3
α-helix	503-505	3
β-strand	509	1	40
β-strand	523-525	3	37
β-strand	526	1	40
β-strand	531-532	2	41
α-helix	539-546	8
β-strand	551-552	2	42
α-helix	558-560	3
β-strand	565-569	5	42
β-strand	572-577	6	42
α-helix	580-591	12
β-strand	602-606	5	42
β-strand	611-615	5	42
β-strand	621-627	7	41
β-strand	628-629	2	43
β-strand	632-633	2	43
α-helix	637-643	7
α-helix	646-649	4
α-helix	653-658	6
β-strand	662-666	5	41
α-helix	667-670	4
β-strand	675-676	2	41
α-helix	679-682	4
β-strand	695-696	2	41
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	44
α-helix	719-728	10
β-strand	732	1	45
β-strand	734	1	46
α-helix	740-742	3
β-strand	747-751	5	46
β-strand	755	1	47
β-strand	759-760	2	48
α-helix	762-765	4
β-strand	776-782	7	49
β-strand	793-797	5	49
α-helix	798-802	5
β-strand	808-817	10	46
β-strand	827-829	3	50
β-strand	837	1	50
β-strand	844	1	51
β-strand	853	1	52
β-strand	859-860	2	46
β-strand	864	1	51
β-strand	865-867	3	52
β-strand	869-872	4	50
β-strand	889-891	3	50
α-helix	893	1
β-strand	894-895	2	52
α-helix	896	1
β-strand	902-911	10	46
β-strand	917-927	11	46
β-strand	934-936	3	49
β-strand	942-949	8	49
β-strand	956	1	53
α-helix	961-963	3
β-strand	965-967	3	49
α-helix	969-971	3
β-strand	977	1	44
α-helix	978-993	16
α-helix	996	1
β-strand	997-998	2	48
α-helix	1008-1017	10
β-strand	1025-1026	2	49
β-strand	1029	1	53
α-helix	1035	1
β-strand	1036	1	53
α-helix	1037	1
β-strand	1041-1050	10	49
β-strand	1051	1	45
α-helix	1055-1057	3
β-strand	1060-1062	3	13
β-strand	1067	1	54
α-helix	1073	1
β-strand	1074	1	54
α-helix	1075	1
α-helix	1078-1080	3
α-helix	1082-1083	2
β-strand	1084-1086	3	12
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	1
β-strand	1125	1	1
β-strand	1127-1129	3	55
β-strand	1134-1136	3	55
β-strand	1137	1	56
β-strand	1142	1	56
β-strand	1146-1152	7	1
α-helix	1153-1164	12
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain c: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	22-34	13
α-helix	36-49	14
α-helix	55-69	15
α-helix	73-80	8
α-helix	83-91	9
α-helix	98-100	3
α-helix	102	1
α-helix	103-124	22
α-helix	129-136	8
α-helix	137-141	5
β-strand	570	1	90
α-helix	571	1
β-strand	576	1	90
α-helix	577	1
β-strand	584-585	2	91
β-strand	589-590	2	91
β-strand	594	1	92
β-strand	600	1	92
α-helix	605-617	13
α-helix	661-664	4
α-helix	668-676	9
α-helix	679-690	12

Chain C: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	57
β-strand	18-24	7	57
α-helix	28-40	13
β-strand	43-55	13	58
α-helix	61-70	10
β-strand	73	1	59
α-helix	82-84	3
β-strand	99-106	8	58
α-helix	112	1
β-strand	113-116	4	60
β-strand	121-122	2	58
β-strand	129	1	59
α-helix	130-132	3
α-helix	145-148	4
β-strand	149-153	5	60
β-strand	158-169	12	58
α-helix	174-176	3
β-strand	179-186	8	57
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	228-235	8	57
α-helix	241-269	29

Chain d: 17 helices, 103 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	93
β-strand	15-21	7	94
β-strand	30-35	6	94
β-strand	38-45	8	94
β-strand	48-54	7	94
β-strand	61-67	7	95
β-strand	76-81	6	95
β-strand	85-94	10	95
β-strand	97-107	11	95
β-strand	115	1	96
β-strand	121-124	4	97
β-strand	130-134	5	97
β-strand	136	1	96
β-strand	139-144	6	97
β-strand	151-154	4	98
β-strand	155-158	4	97
β-strand	163-169	7	99
α-helix	170	1
β-strand	177-184	8	99
β-strand	187-196	10	99
β-strand	201-204	4	99
β-strand	210-211	2	99
β-strand	218-221	4	100
α-helix	222-223	2
β-strand	229-232	4	100
β-strand	237-241	5	100
β-strand	244-248	5	100
β-strand	258-263	6	101
β-strand	270-275	6	101
β-strand	279-284	6	101
β-strand	286-289	4	102
β-strand	295-299	5	102
β-strand	304-307	4	101
α-helix	310-311	2
β-strand	313-316	4	103
β-strand	321-325	5	103
β-strand	331-336	6	103
β-strand	347-353	7	103
β-strand	359-365	7	104
β-strand	374-379	6	104
α-helix	382-384	3
β-strand	386-392	7	104
β-strand	394	1	105
β-strand	396-403	8	106
β-strand	409-413	5	107
β-strand	422	1	108
β-strand	424-429	6	107
β-strand	432-439	8	107
β-strand	442-445	4	107
β-strand	457-463	7	109
β-strand	467-472	6	109
β-strand	476-480	5	109
β-strand	485-490	6	109
α-helix	496-498	3
β-strand	500-503	4	110
β-strand	507-512	6	110
β-strand	515-522	8	110
β-strand	525-533	9	110
β-strand	538-542	5	111
β-strand	555-560	6	111
β-strand	565-570	6	111
β-strand	575-581	7	111
β-strand	588-596	9	112
β-strand	599-606	8	112
β-strand	610-616	7	112
β-strand	623-630	8	112
β-strand	637-643	7	113
β-strand	646-652	7	113
β-strand	657-662	6	113
β-strand	665-670	6	113
β-strand	671	1	105
β-strand	678-682	5	106
β-strand	684	1	108
β-strand	690-694	5	106
β-strand	698-704	7	106
β-strand	710-716	7	104
β-strand	720-727	8	114
β-strand	732-743	12	114
α-helix	744	1
β-strand	749-751	3	114
α-helix	756-758	3
β-strand	762-765	4	114
β-strand	785-795	11	114
β-strand	801-806	6	114
α-helix	807-808	2
β-strand	811-819	9	115
β-strand	828-835	8	115
β-strand	846-854	9	115
β-strand	857-866	10	115
β-strand	870-876	7	116
β-strand	879-884	6	116
β-strand	887-893	7	116
β-strand	899-905	7	116
β-strand	911-917	7	117
β-strand	920-925	6	117
β-strand	930-936	7	117
β-strand	941-947	7	117
β-strand	954-959	6	118
β-strand	964-969	6	118
β-strand	973-979	7	118
α-helix	986-990	5
β-strand	991	1	117
β-strand	992-999	8	118
β-strand	1004-1009	6	93
β-strand	1024-1032	9	93
β-strand	1037-1043	7	93
α-helix	1044	1
α-helix	1045-1061	17
α-helix	1070-1074	5
β-strand	1076-1077	2	119
β-strand	1082-1083	2	119
β-strand	1086	1	118
β-strand	1088-1090	3	93
α-helix	1091-1094	4
α-helix	1097-1099	3
α-helix	1102-1109	8
β-strand	1113-1114	2	120
β-strand	1122-1123	2	120
α-helix	1124-1125	2
α-helix	1126-1137	12

Chain D: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	61
β-strand	21	1	61
α-helix	24-26	3
α-helix	29	1
β-strand	30-31	2	33
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-71	13
α-helix	77-88	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-135	12

11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1984	Sus scrofa	A0A7M4DUC2
DNA-directed RNA polymerase subunit beta	B	protein	1251	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase Rpb4/RPC9 core domain-containing protein	D	protein	142	Sus scrofa	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A8W4F9W9
RNA polymerase II subunit J	K	protein	117	Sus scrofa	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa	A0A4X1TRS6

10 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>9BZ0_1 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT
SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSY
SPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTS
PKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDS
DEEN

Sequence of entity 2 (B), FASTA

>9BZ0_2 DNA-directed RNA polymerase subunit beta (chains B)
MCSTNLSQALAYFRAGANLTAASLWAGFRGSRRIFWERRKRKSLCLALRPGGACWRWLLA
VSCVSLRGLGAPGSCANMYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQ
LDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDG
APSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLL
NGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRS
CLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRD
ILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVL
QKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFL
FRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQAR
AGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLV
KNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQL
MNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQL
KEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMI
LGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRS
MEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGF
DQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGT
NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKG
TCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFN
DAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRA
RGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCG
IMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>9BZ0_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>9BZ0_4 RNA polymerase Rpb4/RPC9 core domain-containing protein (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>9BZ0_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>9BZ0_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>9BZ0_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>9BZ0_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>9BZ0_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>9BZ0_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>9BZ0_11 RNA polymerase II subunit J (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>9BZ0_12 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10
MG	Magnesium ion	Mg	2

Primary citation

STK19 positions TFIIH for cell-free transcription-coupled DNA repair. Mevissen, T.E.T., Kummecke, M., Schmid, E.W. et al. Cell (2024) 187:7091-7106.e24. DOI 10.1016/j.cell.2024.10.020 · PubMed

Other PDB entries of the same protein (UniProt A0A7M4DUC2), best resolution first:

8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
8A40 3.0 Å, Structure of mammalian Pol II-TFIIS elongation complex
6TED 3.1 Å, Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers…
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex
9ER2 3.3 Å, PolII-TCR-STK19 structure.
8S54 3.4 Å, RNA polymerase II early elongation complex bound to TFIIE and TFIIF - state b (composite…

Browse structure collections

About this viewer

MolViewer shows 9BZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.