9QK1: Gamma-aminobutyric acid receptor subunit alpha-2
GABA-A receptor a2b3 (1:4) + a2NB06(silent) + b3Mb125 + GABA. Determined by electron microscopy at 3.05 Å resolution. Released 26 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 3.05 Å
- Organisms
- Homo sapiens, Escherichia coli, Lama glama
- Chains
- 9
- Atoms
- 17,635
- Mol. weight
- 312.25 kDa
- Ligands
- NAG, ABU, HSM
- Released
- 26 Aug 2026
Explore 9QK1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9QK1 contains 75 α-helices and 106 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-21 | 11 | |
| β-strand | 38-53 | 16 | 1 |
| β-strand | 58-70 | 13 | 1 |
| α-helix | 72-74 | 3 | |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 87-92 | 6 | |
| β-strand | 98-100 | 3 | 2 |
| β-strand | 103 | 1 | 1 |
| β-strand | 107-108 | 2 | 1 |
| β-strand | 116-121 | 6 | 1 |
| β-strand | 125-137 | 13 | 1 |
| β-strand | 149-158 | 10 | 2 |
| β-strand | 166-170 | 5 | 1 |
| α-helix | 175-177 | 3 | |
| β-strand | 178-180 | 3 | 1 |
| β-strand | 190-203 | 14 | 2 |
| β-strand | 208-220 | 13 | 2 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-241 | 11 | |
| α-helix | 242-245 | 4 | |
| α-helix | 251-272 | 22 | |
| α-helix | 284-312 | 29 | |
| α-helix | 389-411 | 23 | |
Chain B: 13 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 3 |
| β-strand | 56-68 | 13 | 3 |
| α-helix | 70-72 | 3 | |
| β-strand | 82-83 | 2 | 3 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 4 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 114-118 | 5 | 3 |
| β-strand | 123-135 | 13 | 3 |
| β-strand | 147-148 | 2 | 4 |
| β-strand | 151-156 | 6 | 4 |
| β-strand | 164-168 | 5 | 3 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 3 |
| α-helix | 178-180 | 3 | |
| β-strand | 186-200 | 15 | 4 |
| β-strand | 203-216 | 14 | 4 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-241 | 15 | |
| α-helix | 247-263 | 17 | |
| α-helix | 266-271 | 6 | |
| α-helix | 280-302 | 23 | |
| α-helix | 418-445 | 28 | |
Chain C: 13 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 5 |
| β-strand | 56-68 | 13 | 5 |
| α-helix | 70-72 | 3 | |
| α-helix | 80 | 1 | |
| β-strand | 81-83 | 3 | 5 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 6 |
| β-strand | 101-106 | 6 | 5 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 123-135 | 13 | 5 |
| β-strand | 147-156 | 10 | 6 |
| β-strand | 164-168 | 5 | 5 |
| β-strand | 175-176 | 2 | 5 |
| α-helix | 178-180 | 3 | |
| β-strand | 186-199 | 14 | 6 |
| β-strand | 204-216 | 13 | 6 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 238-241 | 4 | |
| α-helix | 247-265 | 19 | |
| α-helix | 280-307 | 28 | |
| α-helix | 421-446 | 26 | |
Chain D: 12 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-19 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 7 |
| β-strand | 56-68 | 13 | 7 |
| α-helix | 70-72 | 3 | |
| β-strand | 82-83 | 2 | 7 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-97 | 2 | 8 |
| β-strand | 101-106 | 6 | 7 |
| β-strand | 114-118 | 5 | 7 |
| β-strand | 123-135 | 13 | 7 |
| β-strand | 147-148 | 2 | 8 |
| β-strand | 151-156 | 6 | 8 |
| β-strand | 164-168 | 5 | 7 |
| β-strand | 175-176 | 2 | 7 |
| α-helix | 178-180 | 3 | |
| β-strand | 186-199 | 14 | 8 |
| β-strand | 204-216 | 13 | 8 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-241 | 15 | |
| α-helix | 247-270 | 24 | |
| α-helix | 280-306 | 27 | |
| α-helix | 419-427 | 9 | |
| α-helix | 430-445 | 16 | |
Chain E: 14 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-20 | 13 | |
| α-helix | 35 | 1 | |
| β-strand | 36-46 | 11 | 9 |
| β-strand | 50-51 | 2 | 9 |
| β-strand | 56-68 | 13 | 9 |
| α-helix | 70-72 | 3 | |
| β-strand | 82-83 | 2 | 9 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 10 |
| β-strand | 101-106 | 6 | 9 |
| β-strand | 114-117 | 4 | 9 |
| β-strand | 123-135 | 13 | 9 |
| β-strand | 147-148 | 2 | 10 |
| β-strand | 151-156 | 6 | 10 |
| β-strand | 164-168 | 5 | 9 |
| β-strand | 175-176 | 2 | 9 |
| α-helix | 178-180 | 3 | |
| β-strand | 186-199 | 14 | 10 |
| β-strand | 204-216 | 13 | 10 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-262 | 16 | |
| α-helix | 268-271 | 4 | |
| α-helix | 278-279 | 2 | |
| α-helix | 280-307 | 28 | |
| α-helix | 423-445 | 23 | |
Chain F: 2 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 11 |
| β-strand | 10-13 | 4 | 12 |
| β-strand | 18-25 | 8 | 11 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 12 |
| β-strand | 46-51 | 6 | 12 |
| β-strand | 59-60 | 2 | 12 |
| β-strand | 68-73 | 6 | 11 |
| β-strand | 78-83 | 6 | 11 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 12 |
| β-strand | 112-113 | 2 | 12 |
| β-strand | 117-122 | 6 | 12 |
Chain G: 3 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-7 | 6 | 13 |
| β-strand | 405-413 | 9 | 13 |
| α-helix | 415-417 | 3 | |
| β-strand | 420-426 | 7 | 14 |
| β-strand | 433-439 | 7 | 14 |
| β-strand | 445-447 | 3 | 14 |
| α-helix | 449-451 | 3 | |
| β-strand | 457-460 | 4 | 13 |
| β-strand | 465-470 | 6 | 13 |
| β-strand | 479-486 | 8 | 14 |
| α-helix | 496-498 | 3 | |
| β-strand | 499-502 | 4 | 14 |
| β-strand | 506-508 | 3 | 14 |
Chain H: 4 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-7 | 3 | 15 |
| β-strand | 406-410 | 5 | 15 |
| α-helix | 415-417 | 3 | |
| β-strand | 420-426 | 7 | 16 |
| α-helix | 431-432 | 2 | |
| β-strand | 433-439 | 7 | 16 |
| β-strand | 445-447 | 3 | 16 |
| α-helix | 449-451 | 3 | |
| β-strand | 457-460 | 4 | 15 |
| β-strand | 465-469 | 5 | 15 |
| β-strand | 479-486 | 8 | 16 |
| α-helix | 496-498 | 3 | |
| β-strand | 499-502 | 4 | 16 |
| β-strand | 506-508 | 3 | 16 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit alpha-2 | A | protein | 365 | Homo sapiens | P47869 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 | B, C, D, E | protein | 451 | Homo sapiens, Escherichia coli | P0ABE7 (AlphaFold model), P28472 (AlphaFold model) |
| a2NB06 | F | protein | 133 | Lama glama | |
| Mb125 | G, H, I | protein | 133 | Lama glama | |
Sequence of entity 1 (A), FASTA
>9QK1_1 Gamma-aminobutyric acid receptor subunit alpha-2 (chains A)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKSQPARAAKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSPGTTETS
QVAPA
Sequence of entity 2 (B, C, D, E), FASTA
>9QK1_2 Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 (chains B, C, D, E)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFSQPAGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPK
LEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLT
GRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN
Sequence of entity 3 (F), FASTA
>9QK1_3 a2NB06 (chains F)
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYTMGWFRQAPGKEREFVAGDSWSGGSTYY
ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASLAGGPPIADEYNYWGQGTQVT
VSSHHHHHHEPEA
Sequence of entity 4 (G, H, I), FASTA
>9QK1_4 Mb125 (chains G, H, I)
QVQLVESGGGLVQGSLRLSCAASGHTFNYPIMGWFRQAPGKEREFVGAISWSGGSTSYAD
SVKDRFTISRDNAKNTVYLEMNNLKPEDTAVYYCAAKGRYSGGLYYPTNYDYWGQGTQVT
VSSHHHHHHEPEA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 1 |
| HSM | Histamine | C5 H9 N3 | 3 |
Primary citation
Determining the molecular and physiological actions of subtype-selective nanobodies of GABA A receptors. Gonzalez-Prada, J.E., Liu, S., Shang, C. et al. Sci Adv (2026) 12:eaeg3548-eaeg3548. DOI 10.1126/sciadv.aeg3548 · PubMed
Other PDB entries of the same protein (UniProt P47869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
- 9QJX 2.7 Å, GABA-A receptor a2b3g2 + a2NB00(PAM) + GABA
- 9QJY 2.78 Å, GABA-A receptor a2b3g2 + a2NB04(silent) + GABA
- 9QJR 2.92 Å, GABA-A receptor a2b3 (1:4) + a2NB29(near-silent) + b3Mb125 + GABA
- 9QK0 3.01 Å, GABA-A receptor a2b3g2 + a2NB25(inhibitor)
- 9CRV 3.18 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly
- 9CT0 3.19 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly
- 9CX7 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly
- 9CXC 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly
- 9CXB 3.33 Å, Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly
- 9CSB 3.34 Å, Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly
- 9CTV 3.36 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly
Browse structure collections
About this viewer
MolViewer shows 9QK1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.