9QWO: Vinculin tail
Vinculin tail bound to paxillin LD2. Determined by X-ray diffraction at 2.54 Å resolution. Released 23 Apr 2025.
- Method
- X-ray diffraction
- Resolution
- 2.54 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,922
- Mol. weight
- 89.25 kDa
- Released
- 23 Apr 2025
Explore 9QWO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9QWO contains 32 α-helices and 8 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 8 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 896-909 | 14 | |
| β-strand | 912 | 1 | 1 |
| α-helix | 918-936 | 19 | |
| α-helix | 943-971 | 29 | |
| β-strand | 972 | 1 | 2 |
| α-helix | 975-985 | 11 | |
| α-helix | 988-1005 | 18 | |
| α-helix | 1013-1044 | 32 | |
| α-helix | 1045-1047 | 3 | |
| β-strand | 1048 | 1 | 2 |
| β-strand | 1060 | 1 | 1 |
| α-helix | 1061-1062 | 2 | |
Chain B: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 896-910 | 15 | |
| α-helix | 918-936 | 19 | |
| α-helix | 943-971 | 29 | |
| α-helix | 975-985 | 11 | |
| α-helix | 988-1005 | 18 | |
| α-helix | 1013-1044 | 32 | |
Chain C: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 896-910 | 15 | |
| β-strand | 912 | 1 | 3 |
| α-helix | 918-936 | 19 | |
| α-helix | 943-971 | 29 | |
| β-strand | 972 | 1 | 4 |
| α-helix | 975-985 | 11 | |
| α-helix | 988-1005 | 18 | |
| α-helix | 1013-1044 | 32 | |
| β-strand | 1048 | 1 | 4 |
| β-strand | 1060 | 1 | 3 |
| α-helix | 1061-1063 | 3 | |
Chain D: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 896-910 | 15 | |
| α-helix | 918-936 | 19 | |
| α-helix | 943-971 | 29 | |
| α-helix | 975-985 | 11 | |
| α-helix | 988-1004 | 17 | |
| α-helix | 1013-1044 | 32 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 144-153 | 10 | |
Chain F: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 141-143 | 3 | |
| α-helix | 144-153 | 10 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-10 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Isoform 1 of Vinculin | A, B, C, D | protein | 181 | Homo sapiens | P18206 (AlphaFold model) |
| Isoform Gamma of Paxillin | E, F | protein | 19 | Homo sapiens | P49023 (AlphaFold model) |
| Paxillin | G, H | protein | 13 | Homo sapiens | A0A1B0GTU4 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>9QWO_1 Isoform 1 of Vinculin (chains A, B, C, D)
GPLGSGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKR
ALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATM
LGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWY
Q
Sequence of entity 2 (E, F), FASTA
>9QWO_2 Isoform Gamma of Paxillin (chains E, F)
SNLSELDRLLLELNAVQHN
Sequence of entity 3 (G, H), FASTA
>9QWO_3 Paxillin (chains G, H)
MDDLDALLADLES
Primary citation
Phospho-regulated tethering of focal adhesion kinase to vinculin links force transduction to focal adhesion signaling. Diaz-Palacios, K., Lopez Navajas, P., Rodrigo Martin, B. et al. Cell Commun Signal (2025) 23:190-190. DOI 10.1186/s12964-025-02201-3 · PubMed
Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
- 4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
- 3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
- 1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
- 3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
- 3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
- 3MYI 2.2 Å, Human metavinculin tail domain
- 4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
- 1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
- 1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
- 5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
- 3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
Browse structure collections
About this viewer
MolViewer shows 9QWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.