12DL: Tubulin beta-4B chain

Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs. Determined by electron microscopy at 3.5 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Mus musculus
Chains: 33
Atoms: 133,296
Mol. weight: 2137.88 kDa
Ligands: GTP, MG, ZN, CA
Released: 8 Apr 2026

Explore 12DL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

12DL contains 728 α-helices and 1,014 β-strands across 33 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AA: 26 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	195
β-strand	15-20	6	196
β-strand	25-28	4	195
α-helix	29-31	3
β-strand	41-44	4	196
β-strand	49-51	3	195
β-strand	74-78	5	195
β-strand	90-94	5	196
α-helix	102-105	4
β-strand	108-114	7	196
β-strand	115-120	6	197
β-strand	149-151	3	198
β-strand	153	1	197
α-helix	175-177	3
β-strand	179-186	8	197
α-helix	189-192	4
β-strand	195-200	6	198
α-helix	203-207	5
β-strand	209-214	6	197
β-strand	221-225	5	197
β-strand	226	1	199
β-strand	229	1	199
β-strand	231-233	3	198
α-helix	234-236	3
β-strand	242-249	8	197
β-strand	254	1	200
β-strand	257	1	200
β-strand	260-269	10	198
α-helix	270-271	2
β-strand	279-290	12	198
α-helix	291-293	3
β-strand	294-295	2	201
α-helix	301	1
β-strand	302-307	6	202
α-helix	316-326	11
β-strand	330-333	4	202
β-strand	349-355	7	201
β-strand	360-366	7	201
α-helix	377-380	4
α-helix	383	1
β-strand	389-390	2	201
α-helix	404-406	3
β-strand	407-409	3	203
α-helix	410-411	2
β-strand	413-415	3	204
β-strand	418-420	3	204
β-strand	425-427	3	203
α-helix	442-449	8
β-strand	457-458	2	203
β-strand	464	1	205
β-strand	473-477	5	206
β-strand	488-494	7	206
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	207
α-helix	521-526	6
β-strand	533	1	207
α-helix	534-539	6
α-helix	541-564	24
α-helix	569-571	3
β-strand	572-576	5	206
β-strand	579-582	4	205
β-strand	597-600	4	205
β-strand	609-611	3	208
β-strand	614-618	5	208
α-helix	619	1
β-strand	624-625	2	209
β-strand	628-629	2	209
α-helix	630-639	10
α-helix	640-642	3
β-strand	645-649	5	208
β-strand	668-670	3	202
α-helix	671-673	3
α-helix	677-679	3

Chain AB: 25 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	210
β-strand	15-20	6	211
β-strand	25-28	4	210
α-helix	29-31	3
β-strand	41-44	4	211
β-strand	49-51	3	210
β-strand	74-78	5	210
β-strand	90-94	5	211
α-helix	102-105	4
β-strand	108-114	7	211
β-strand	115-119	5	212
β-strand	141	1	213
β-strand	147	1	213
β-strand	149-151	3	214
β-strand	153	1	212
β-strand	179-186	8	212
α-helix	189-192	4
β-strand	195-200	6	214
α-helix	203-207	5
β-strand	209-214	6	212
β-strand	221-225	5	212
β-strand	226	1	215
β-strand	229	1	215
β-strand	231-234	4	214
α-helix	235-236	2
β-strand	242-249	8	212
β-strand	254	1	216
β-strand	257	1	216
β-strand	260-269	10	214
β-strand	279-290	12	214
α-helix	291-293	3
β-strand	294-295	2	217
α-helix	301	1
β-strand	302-307	6	218
α-helix	316-326	11
β-strand	330-333	4	218
β-strand	349-355	7	217
β-strand	360-366	7	217
α-helix	383	1
β-strand	389-390	2	217
α-helix	404-406	3
β-strand	407-409	3	219
α-helix	410-411	2
β-strand	413-415	3	220
β-strand	418-420	3	220
β-strand	425-427	3	219
β-strand	429	1	221
β-strand	439	1	221
α-helix	442-449	8
β-strand	457-458	2	219
β-strand	464	1	222
α-helix	469-471	3
β-strand	473-477	5	223
β-strand	488-494	7	223
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	224
α-helix	521-524	4
α-helix	525-527	3
β-strand	533	1	224
α-helix	534-539	6
α-helix	541-564	24
α-helix	569-571	3
β-strand	572-576	5	223
β-strand	579-582	4	222
β-strand	597-600	4	222
β-strand	609-611	3	225
β-strand	614-618	5	225
α-helix	619	1
β-strand	624-625	2	226
β-strand	628-629	2	226
α-helix	630-639	10
β-strand	645-649	5	225
α-helix	653-655	3
β-strand	668-670	3	218
α-helix	671-673	3
α-helix	677-679	3

Chain AC: 28 helices, 58 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	89
β-strand	15-20	6	90
β-strand	25	1	91
β-strand	26-27	2	89
β-strand	28	1	92
α-helix	29-31	3
β-strand	41-44	4	90
β-strand	51	1	93
β-strand	74	1	92
β-strand	76	1	93
β-strand	77	1	91
β-strand	89-94	6	90
β-strand	95	1	94
α-helix	102-104	3
β-strand	105	1	94
β-strand	108-114	7	90
β-strand	115-120	6	95
β-strand	141	1	96
β-strand	147	1	96
β-strand	150-151	2	97
β-strand	153	1	95
α-helix	175-177	3
β-strand	179-186	8	95
α-helix	189-192	4
β-strand	195-200	6	97
α-helix	203-206	4
β-strand	209-214	6	95
β-strand	221-225	5	95
β-strand	226	1	98
β-strand	229	1	98
β-strand	231-233	3	97
α-helix	234-236	3
β-strand	242-249	8	95
β-strand	254	1	99
β-strand	257	1	99
β-strand	260-269	10	97
β-strand	279-290	12	97
α-helix	291-293	3
β-strand	294	1	100
α-helix	301	1
β-strand	302-307	6	101
α-helix	316-326	11
β-strand	330-333	4	101
β-strand	349-355	7	100
β-strand	360-366	7	100
α-helix	378-381	4
α-helix	383	1
β-strand	389-390	2	100
α-helix	404-406	3
β-strand	407-409	3	102
α-helix	410-411	2
β-strand	413	1	103
β-strand	420	1	103
β-strand	425-427	3	102
β-strand	429	1	104
β-strand	439	1	104
α-helix	442-449	8
β-strand	457-458	2	102
β-strand	464	1	105
α-helix	469-471	3
β-strand	473-477	5	106
β-strand	488-494	7	106
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	107
α-helix	521-526	6
β-strand	533	1	107
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	106
β-strand	579-582	4	105
α-helix	589-591	3
β-strand	597-600	4	105
α-helix	603-604	2
β-strand	609-611	3	108
β-strand	614-618	5	108
α-helix	619	1
β-strand	624-625	2	109
β-strand	628-629	2	109
α-helix	630-639	10
α-helix	640-642	3
β-strand	645-649	5	108
β-strand	668-670	3	101
α-helix	671-673	3
α-helix	677-679	3

Chain AD: 30 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	110
β-strand	15-20	6	111
β-strand	25-28	4	110
α-helix	29-31	3
β-strand	41-44	4	111
β-strand	49-51	3	110
β-strand	74-78	5	110
β-strand	89-94	6	111
β-strand	95	1	112
α-helix	102-104	3
β-strand	105	1	112
β-strand	108-114	7	111
β-strand	115-119	5	113
α-helix	136-138	3
β-strand	149-151	3	114
β-strand	153	1	113
α-helix	175-177	3
β-strand	179-186	8	113
α-helix	189-192	4
β-strand	195-200	6	114
α-helix	203-207	5
β-strand	209-214	6	113
β-strand	221-225	5	113
β-strand	226	1	115
β-strand	229	1	115
β-strand	231-234	4	114
α-helix	235-236	2
β-strand	242-249	8	113
β-strand	254	1	116
β-strand	257	1	116
β-strand	260-269	10	114
α-helix	270-271	2
β-strand	279-290	12	114
α-helix	291-293	3
β-strand	294-295	2	117
α-helix	301	1
β-strand	302-307	6	118
α-helix	316-326	11
β-strand	330-333	4	118
β-strand	349-355	7	117
β-strand	360-366	7	117
α-helix	378-381	4
α-helix	383	1
β-strand	389-390	2	117
α-helix	404-406	3
β-strand	407-409	3	119
α-helix	410-412	3
β-strand	413-415	3	120
β-strand	418-420	3	120
β-strand	425-427	3	119
β-strand	429	1	121
β-strand	439	1	121
α-helix	442-449	8
β-strand	457-458	2	119
β-strand	464	1	122
α-helix	469-471	3
β-strand	473-477	5	123
β-strand	488-494	7	123
α-helix	495-505	11
α-helix	506-510	5
α-helix	513	1
β-strand	514	1	124
α-helix	521-526	6
β-strand	533	1	124
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	123
β-strand	579-582	4	122
β-strand	597-600	4	122
α-helix	603-604	2
β-strand	609-611	3	125
β-strand	614-618	5	125
α-helix	619	1
β-strand	624-625	2	126
β-strand	628-629	2	126
α-helix	630-639	10
α-helix	640-642	3
β-strand	645-649	5	125
β-strand	668-670	3	118
α-helix	671-673	3
α-helix	677-679	3

Chain AE: 25 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	127
β-strand	15-20	6	128
β-strand	25-27	3	127
β-strand	41-43	3	129
β-strand	51	1	127
β-strand	75-77	3	127
β-strand	89-91	3	128
β-strand	92-94	3	129
α-helix	102-105	4
β-strand	109-114	6	128
β-strand	115-120	6	130
β-strand	141	1	131
β-strand	147	1	131
β-strand	150-151	2	132
β-strand	153	1	130
β-strand	179-186	8	130
α-helix	189-192	4
β-strand	195-200	6	132
α-helix	203-206	4
β-strand	209-214	6	130
β-strand	221-225	5	130
β-strand	226	1	133
β-strand	229	1	133
β-strand	231-233	3	132
α-helix	234-236	3
β-strand	242-249	8	130
β-strand	254	1	134
β-strand	257	1	134
β-strand	260-269	10	132
β-strand	279-290	12	132
α-helix	291-293	3
β-strand	294	1	135
α-helix	301	1
β-strand	302-307	6	136
α-helix	316-326	11
β-strand	330-333	4	136
β-strand	349-355	7	135
β-strand	360-366	7	135
α-helix	378-381	4
α-helix	383	1
β-strand	389-390	2	135
α-helix	404-406	3
β-strand	407-409	3	137
α-helix	410-411	2
β-strand	413-415	3	138
β-strand	418-420	3	138
β-strand	425-427	3	137
β-strand	429	1	139
β-strand	439	1	139
α-helix	442-449	8
β-strand	457-458	2	137
β-strand	464	1	140
β-strand	473-477	5	141
β-strand	488-494	7	141
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	142
α-helix	521-526	6
β-strand	533	1	142
α-helix	534-539	6
α-helix	541-564	24
α-helix	569-571	3
β-strand	572-576	5	141
β-strand	579-582	4	140
α-helix	589-591	3
β-strand	597-600	4	140
α-helix	603-604	2
β-strand	611	1	143
β-strand	614-618	5	143
β-strand	624-625	2	144
β-strand	628-629	2	144
α-helix	632-639	8
α-helix	640-642	3
β-strand	645-649	5	143
α-helix	653-655	3
β-strand	668-670	3	136
α-helix	671-673	3
α-helix	677-679	3

Chain AF: 29 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	145
β-strand	15-20	6	146
β-strand	25-28	4	145
α-helix	29-31	3
β-strand	41-44	4	146
β-strand	49-51	3	145
β-strand	74-78	5	145
β-strand	89-94	6	146
α-helix	102-105	4
β-strand	108-114	7	146
β-strand	115-119	5	147
α-helix	136-138	3
β-strand	149-151	3	148
β-strand	153	1	147
α-helix	175-177	3
β-strand	179-186	8	147
α-helix	189-192	4
β-strand	195-200	6	148
α-helix	203-206	4
β-strand	209-213	5	147
β-strand	222-225	4	147
β-strand	226	1	149
β-strand	229	1	149
β-strand	231-234	4	148
α-helix	235-236	2
β-strand	242-249	8	147
β-strand	254	1	150
β-strand	257	1	150
β-strand	260-269	10	148
β-strand	279-290	12	148
α-helix	291-293	3
β-strand	294-295	2	151
α-helix	301	1
β-strand	302-307	6	152
α-helix	316-326	11
β-strand	330-333	4	152
β-strand	349-355	7	151
β-strand	360-366	7	151
α-helix	377-381	5
α-helix	383	1
β-strand	387-390	4	151
α-helix	404-406	3
β-strand	407-409	3	153
α-helix	410-411	2
β-strand	413-415	3	154
β-strand	418-420	3	154
β-strand	425-429	5	153
α-helix	442-449	8
β-strand	457-460	4	153
β-strand	464	1	155
α-helix	469-471	3
β-strand	473-477	5	156
β-strand	488-494	7	156
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	157
α-helix	521-526	6
β-strand	533	1	157
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	156
β-strand	579-582	4	155
β-strand	597-600	4	155
α-helix	603-604	2
β-strand	609-611	3	158
β-strand	614-618	5	158
α-helix	619	1
β-strand	624-625	2	159
β-strand	628-629	2	159
α-helix	630-639	10
α-helix	640-642	3
β-strand	645-649	5	158
α-helix	653-655	3
β-strand	668-670	3	152
α-helix	671-673	3
α-helix	677-679	3

Chain AG: 28 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	160
β-strand	15-20	6	161
β-strand	25-28	4	160
α-helix	29-31	3
β-strand	41-44	4	161
β-strand	49-51	3	160
β-strand	74-78	5	160
β-strand	90-94	5	161
β-strand	95	1	162
α-helix	102-104	3
β-strand	105	1	162
β-strand	108-114	7	161
β-strand	115-120	6	163
β-strand	141	1	164
β-strand	147	1	164
β-strand	149-151	3	165
β-strand	153	1	163
α-helix	175-177	3
β-strand	179-186	8	163
α-helix	189-192	4
β-strand	195-200	6	165
α-helix	203-207	5
β-strand	209-214	6	163
β-strand	221-225	5	163
β-strand	226	1	166
β-strand	229	1	166
β-strand	231-233	3	165
α-helix	234-236	3
β-strand	242-249	8	163
β-strand	254	1	167
β-strand	257	1	167
β-strand	260-269	10	165
α-helix	270-271	2
β-strand	279-290	12	165
α-helix	291-293	3
β-strand	294-295	2	168
α-helix	301	1
β-strand	302-307	6	169
α-helix	316-327	12
β-strand	330-333	4	169
β-strand	349-355	7	168
β-strand	360-366	7	168
α-helix	378-381	4
α-helix	383	1
β-strand	389-390	2	168
α-helix	404-406	3
β-strand	407-409	3	170
α-helix	410-411	2
β-strand	413-415	3	171
β-strand	418-420	3	171
β-strand	425-429	5	170
α-helix	442-449	8
β-strand	457-460	4	170
β-strand	464	1	172
α-helix	469-471	3
β-strand	473-477	5	173
β-strand	488-494	7	173
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	174
α-helix	521-526	6
β-strand	533	1	174
α-helix	534-539	6
α-helix	541-564	24
α-helix	569-571	3
β-strand	572-576	5	173
β-strand	579-582	4	172
β-strand	597-600	4	172
α-helix	603-604	2
β-strand	609-611	3	175
β-strand	614-618	5	175
α-helix	619	1
β-strand	624-625	2	176
β-strand	628-629	2	176
α-helix	630-639	10
α-helix	640-642	3
β-strand	645-649	5	175
β-strand	668-670	3	169
α-helix	671-673	3
α-helix	677-679	3

Chain AH: 27 helices, 54 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	177
β-strand	15-20	6	178
β-strand	25-27	3	177
α-helix	29-32	4
β-strand	41-44	4	178
β-strand	51	1	177
β-strand	75-77	3	177
β-strand	89-94	6	178
β-strand	95	1	179
α-helix	102-104	3
β-strand	105	1	179
β-strand	108-114	7	178
β-strand	115-120	6	180
α-helix	136-138	3
β-strand	141	1	181
β-strand	147	1	181
β-strand	149-151	3	182
β-strand	153	1	180
α-helix	175-177	3
β-strand	179-186	8	180
α-helix	189-192	4
β-strand	195-200	6	182
α-helix	203-206	4
β-strand	209-214	6	180
β-strand	221-225	5	180
β-strand	226	1	183
β-strand	229	1	183
β-strand	231-233	3	182
α-helix	234-236	3
β-strand	242-249	8	180
β-strand	254	1	184
β-strand	257	1	184
β-strand	260-269	10	182
β-strand	279-290	12	182
α-helix	291-293	3
β-strand	294-295	2	185
α-helix	301	1
β-strand	302-307	6	186
α-helix	316-326	11
β-strand	330-333	4	186
β-strand	349-355	7	185
β-strand	360-366	7	185
α-helix	377-379	3
α-helix	383	1
β-strand	387-390	4	185
α-helix	404-406	3
β-strand	407-409	3	187
α-helix	410-411	2
β-strand	413-415	3	188
β-strand	418-420	3	188
β-strand	425-427	3	187
β-strand	429	1	189
β-strand	439	1	189
α-helix	442-449	8
β-strand	457-458	2	187
β-strand	464	1	190
α-helix	469-471	3
β-strand	473-477	5	191
β-strand	488-494	7	191
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	192
α-helix	521-526	6
β-strand	533	1	192
α-helix	534-538	5
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	191
β-strand	579-582	4	190
β-strand	597-600	4	190
α-helix	604	1
β-strand	609-611	3	193
β-strand	614-618	5	193
α-helix	619	1
β-strand	624-625	2	194
β-strand	628-629	2	194
α-helix	630-639	10
β-strand	645-649	5	193
β-strand	668-670	3	186
α-helix	671-673	3
α-helix	677-679	3

25 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin beta-4B chain	FA	protein	445	Mus musculus	P68372 (AlphaFold model)
NACHT, LRR and PYD domains-containing protein 5	GA, GB	protein	1163	Mus musculus	Q9R1M5 (AlphaFold model)
Oocyte-expressed protein homolog	IA, JA	protein	164	Mus musculus	Q9CWE6 (AlphaFold model)
Transducin-like enhancer protein 6	HA, HB	protein	581	Mus musculus	Q9WVB3 (AlphaFold model)
Zinc finger BED domain-containing protein 3	KA	protein	227	Mus musculus	Q9D0L1
KH domain-containing protein 3	LA	protein	440	Mus musculus	Q9CWU5
NLR family, pyrin domain containing 4F	MA	protein	937	Mus musculus	L7N1W9
Inactive protein-arginine deiminase type-6	AA, AB, AC, AD, AE, AF, AG, AH, AI, AJ	protein	682	Mus musculus	Q8K3V4
Tubulin alpha-1C chain	EA	protein	449	Mus musculus	P68373
NACHT, LRR and PYD domains-containing protein 14	DA, DB	protein	993	Mus musculus	Q6B966
E3 ubiquitin-protein ligase UHRF1	BA, BB	protein	782	Mus musculus	Q8VDF2
Ubiquitin-conjugating enzyme E2 D3	CA, CB	protein	147	Mus musculus	P61079

4 more molecules are not listed.

Sequence of entity 1 (FA), FASTA

>12DL_1 Tubulin beta-4B chain (chains FA)
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA

Sequence of entity 2 (GA, GB), FASTA

>12DL_2 NACHT, LRR and PYD domains-containing protein 5 (chains GA, GB)
MGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKES
KAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKDSKAILKARG
LEEEQKSESTMSPSENVSRAILKDSGSEEVEQASERKMTSPENDSKSIQKDQGPEQEQTS
ETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDTSVDLHYDSPEMKLLSDAFKPYQKTF
QPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVREIKWTEKSSLAQLIAK
ECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDWKDEQPIYILMYSLLRK
ALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLVLENISNESDRIQVFHS
LIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGLYATLVFHQLTLKRPSQ
SALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEILALFHMNILLQVGHNS
EQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEVKRTDDTRLLGMKRFLF
GLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYCLFESQDEE
FVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTLELCPVVTV
QETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKILCLELRNQSCRIQKLTF
KSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVETLRLDSCE
LTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLILDNCGLTP
ASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAY
GFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDL
ACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLA
ISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFV
KPHVVIDGDWYASDEDDRNWWKN

Sequence of entity 3 (IA, JA), FASTA

>12DL_3 Oocyte-expressed protein homolog (chains IA, JA)
MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGT
DQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRA
VKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES

Sequence of entity 4 (HA, HB), FASTA

>12DL_4 Transducin-like enhancer protein 6 (chains HA, HB)
MTSHRQSSDTFGGILPSTLSSRYLSIVNQLPEEFSSVVSEMMVHLENIFSLAENFFQAIE
RFSRTPDLLERNKMSIGVGAEGDSWPCHVSHEAPMGSAQTTENSAKEEDKQVPESAALQH
PKFKSTPGPQLPTRRRFLSESDELQDPQPVWDAEPQFCQGFLIQGLWELFMDSRQKNQQE
HGGEDSSQESKDSGLCDFKPEPQPRHRNSLSDSADPFLIKSPSALLDYYQEDVSRPQPET
QESSGRADKFLKPLSWGSEVLESSCNQPSTALWQLERFTVPQALQKVRVLKHQELLLVVA
VSSFTRHVFTCSQSGIKVWNLVNQVAEDRDPESHLKCSVQDNKVYLRTCLLSSNSRTLFA
GGYNLPGVIVWDLAAPSLYEKCQLPCEGLSCQALANTKENMALAGFTDGTVRIWDLRTQE
IVRNLKGPTNSARNLVVKDDNIWTGGLDACLRCWDLRMAKVSLEHLFQSQIMSLAHSPTE
DWLLLGLANGQHCLFNSRKRDQVLTVDTKDNTILGLKFSPNGKWWASVGMGNFITVHSMP
TGAKLFQVPEVGPVRCFDMTENGRLIITGSRDCASVYHIKY

Sequence of entity 5 (KA), FASTA

>12DL_5 Zinc finger BED domain-containing protein 3 (chains KA)
KSKKPLKITMEDSRRLNDPAEQGGLCPAPVGPSYSEAWGYFHLDPAQPRHRMMSAWATCR
LCGLQVGGLPNFQMWTRALCQHLSDVHLPELKKSAAPSSPTTMPCPPPPSPTMAAEGDWA
RLLEQMGELAMRGSQRELELERREAALMQAELELERKRQALKQEAQSVEQERHQLQVERE
ALSKWIKKQSPGAQVPEPPSPLPLLPKEDPDIHDNNSDNDMVTKVLL

Sequence of entity 6 (LA), FASTA

>12DL_6 KH domain-containing protein 3 (chains LA)
MASLKRFQTLVPLDHKQGTLFEIIGEPKLPKWFHVECLEDPKRLYVEPRLLEIMFGKDGE
HIPHLESMLHTLIHVNVWGPERRAEIWIFGPPPFRRDVDRMLTDLAHYCRMKLMEIEALE
AGVERRRMAAHKAATQPAPVKVREAAPRPASVKVPETATQPAPVKVREAAPQPAPVQEVR
EAAPQQASVQEEVREAATEQAPVQEVREAATEQAPVQEVSEAATEQAPVQEVNEAATEQA
SVQAVREAATRPAPGKVRKAATQPAPVQVCQEATQLAPVKVREAATQPASGKVREAATQL
APVKVRKAATQLAPVKVHEAATQPAPGKVSDAATQSASVQVREAATQLSPVEATDTSQLA
QVKADEAFAQHTSGEAHQVANGQSPIEVCETATGQHSLDVSRALSQKCPEVFEWETQSCL
DGSYVIVQPPRDAWESFIIL

Sequence of entity 7 (MA), FASTA

>12DL_7 NLR family, pyrin domain containing 4F (chains MA)
MASFISDFGLIWYLRELNKKEFMKFKDFLIQEILELKLKQVSSTKVKKASREDLANLLLK
CGENQAWDMTFRILQKINRKDLTERATGAIVGNPNLYRDHLKKKLTHDCPKKFNVRIQDF
IKETFIQNDYDAFENLLISKGTERKPHMVFLKGMAGVGKTLMLKNLMLAWSKGLVFQNKF
SYAFYFCCQDVKQLKTASLAELISREWPSPSAPIEEILSQPEKLLFIIDSLEGMEWDLTK
QESELCDDCMEKQPVSTLLSSLLRRKMLPESSLLLSTTPETFEKMEDRIQCTDVKTATAF
DERSMKIYFHRLFQDRKRAQEAFSLVRENKQLFTICQVPLLCWMVATCLKEEIEKGGDPV
SLCRRTTSLYTTHIFSLFIPQSAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFGKEALRRN
GIFDSDIPTLLDIGMLGKIREFENSYIFLHPSVQEVCAAIFYMLKRHVEHPSQDVKNIET
VLFMFLKKVKTQWIFLGCFIFGLLQKSEQEKLGVFFGHRLSKNIHHKLYQCLETLSGNAE
LQEQIDGMRLFSCLFEMEDEAFLVKAMNCMQQINFVAKNYSDFIVAAYCLKHCSTLKKLS
FSTENVLNEGDQSYMEELLICWNNMCSVFVRSKDIQELRIKDTNFNEPAIRVLYESLKYP
SFTLNKLVANNVSFGDNHVLFELIQNSSLQYLDLSCSFLSHNEVKLLCDILNQAECNIEK
LMIAHCKLSPDDCKIFGSILMSSKSLKVLNLASNNLNQGISSLCKALCHPHCTLEYLVLS
NCSLSEQCWDYLSEVLRQNKTLSHLDISSNDLKDEGLKILCRSLILPYCVLESLCLSCCG
ITERGCQDLAEVLKNNQNLKYLHVSYNKLKDTGVMLLCDAIKHPNCHLKDLQLEACEITD
ASNEELCYAFMQCETLQTLNLMGNAFEVSRMVFFPRF

Sequence of entity 8 (AA, AB, AC, AD, AE, AF, AG, AH, AI, AJ), FASTA

>12DL_8 Inactive protein-arginine deiminase type-6 (chains AA, AB, AC, AD, AE, AF, AG, AH, AI, AJ)
MSFQNSLSLSLVNPTHALCMVGMEITLDISKCAPDKCKSFTIRGSPRILIHISSSVIAGK
EDTVVWRSMNHPTVALVRMVAPSPTVDEDKVLVSYFCPDQEVPTATAVLFLTGIEISLEA
DIYRDGQLDMPSDKQAKKKWMWGMNGWGAILLVNCSPNAVGQPDEQSFQEGPREIQNLSQ
MNVTVEGPTSILQNYQLILHTSEEEAKKTRVYWSQRGSSAYELVVGPNKPVYLLPTFENR
RKEAFYVEATEFPSPSFSGLISLSLSLVEKAHDECIPEIPLYKDTVMFRVAPYIFMPSTQ
MPLEVYLCRELQLQGFVDSVTKLSEKSKVQVVKVYEDPNRQSKWLQDEMAFCYTQAPHKT
VSLILDTPRVSKLEDFPMKYTLTPGSGYLIRQTEDHRVASLDSIGNLMVSPPVKAQGKDY
PLGRVLIGGSFYPSSEGRDMNKGLREFVYAQQVQAPVELFSDWLMTGHMDQFMCFVPTND
KNNDQKDFRLLLASPSACFELFEQKQKEGYGNVTLFEDIGAEQLLSNGRESKTISQILAD
KSFREQNTYVEKCISLNRTLLKTELGLEDKDIILIPQLFCLEQLTNVPSNQQSTKLFARP
YFPDMLQIIVLGKNLGIPKPFGPKINGTCCLEEKVCGLLEPLGLKCTFIDDFDCYLANIG
DVCASAIINRVPFAFKWWKMTP

Sequence of entity 9 (EA), FASTA

>12DL_9 Tubulin alpha-1C chain (chains EA)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSAEGDDEGEEY

Sequence of entity 10 (DA, DB), FASTA

>12DL_10 NACHT, LRR and PYD domains-containing protein 14 (chains DA, DB)
MKTEDDEMEYEASKEETVSEDKDFDDGIDYRTVIKENIFTMWYKTSLHGEFATLNCVITP
KDQNLLQHIFDEDIQTSEAPQTVVLQGAAGIGKTTLLKKAVLEWADGNLYQQFTHVFYLN
GKEISQVKEKSFAQLISKHWPSSEGPIEQVLSKPSSLLFIIDSFDELDFSFEEPQFALCK
DWTQISPVSFLISSLLRKVMLPESYLLVATRSTAWKRLVPLLQKPQRVKLSGLSKNARMD
YIHHLLKDKAWATSAIYSLRMNWRLFHMCHVCHMCQMICAVLKGQVEKGGRVEETCKTST
ALFTYYICSLFPRIPVGCVTLPNETLLRSLCKAAVEGIWTMKHVLYQQNLRKHELTREDI
LLFLDAKVLQQDTEYENCYMFTHLHVQEFFAALFYLLRENLEEQDYPSEPFENLYLLLES
NHIHDPHLEQMKCFLFGLLNKDRVRQLEETFNLTISMEVREELLACLEGLEKDDSSLSQL
RFQDLLHCIYETQDQEFITQALMYFQKIIVRVDEEPQLRIYSFCLKHCHTLKTMRLTARA
DLKNMLDTAEMCLEGAAVQVIHYWQDLFSVLHTNESLIEMDLYESRLDESLMKILNEELS
HPKCKLQKLIFRAVDFLNGCQDFTFLASNKKVTHLDLKETDLGVNGLKTLCEALKCKGCK
LRVLRLASCDLNVARCQKLSNALQTNRSLVFLNLSLNNLSNDGVKSLCEVLENPNSSLER
LALASCGLTKAGCKVLSSALTKSKRLTHLCLSDNVLEDEGIKLLSHTLKHPQCTLQSLVL
RSCSFTPIGSEHLSTALLHNRSLVHLDLGQNKLADNGVKLLCHSLQQPHCNLQELELMSC
VLTSKACGDLASVLVNNSNLWSLDLGHNILDDAGLNILCDALRNPNCHVQRLGLENCGLT
PGCCQDLLGILSNNKSVIQMNLMKNALDHESIKNLCKVLRSPTCKMEFLALDKKEILKKK
IKKFLVDVRINNPHLVIGPECPNTESGCWWNYF

Sequence of entity 11 (BA, BB), FASTA

>12DL_11 E3 ubiquitin-protein ligase UHRF1 (chains BA, BB)
MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFD
YDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDK
TVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMY
HVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEIC
RKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNT
GKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPE
PEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPA
NHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNY
FTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVV
RNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKD
RTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRAS
KKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELV
FRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGS
GR

Sequence of entity 12 (CA, CB), FASTA

>12DL_12 Ubiquitin-conjugating enzyme E2 D3 (chains CA, CB)
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	11
CA	Calcium ion	Ca	1

Primary citation

Cytoplasmic lattices store developmentally poised degradative and cytoskeletal complexes in mammalian eggs. Li, Y., Zheng, W., Leem, J. et al. Nat Struct Mol Biol (2026) 33:1381-1392. DOI 10.1038/s41594-026-01843-2 · PubMed

Other PDB entries of the same protein (UniProt P68372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IYJ 3.5 Å, Cryo-EM structure of the 48-nm repeat doublet microtubule from mouse sperm
9V10 3.7 Å, Cryo-EM structure of the 48-nm repeat doublet microtubule from mouse sperm
9XRL 3.74 Å, Structure of mouse cytoplasmic lattice (CPL) repeating unit
9SFP 4.2 Å, Native cytoplasmic lattices from mouse oocytes
8I7O 4.5 Å, In situ structure of axonemal doublet microtubules in mouse sperm with 16-nm repeat
9T63 4.7 Å, Asymmetric unit of a cytoplasmic lattice filament repeat unit
9T66 5.3 Å, Complex linking two repeat units of a cytoplasmic lattice filament
8I7R 6.5 Å, In situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat
9T64 7.3 Å, Cytoplasmic lattice filament repeat unit with the central FBXW-SKP1 complex
8TO0 7.7 Å, 48-nm repeating structure of doublets from mouse sperm flagella
9IJJ 7.7 Å, In situ structure of the central apparatus in mouse sperm axoneme.
9T67 7.7 Å, Cytoplasmic lattice filament repeat unit with ubiquitin

Browse structure collections

About this viewer

MolViewer shows 12DL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.