1AE9: Lambda integrase catalytic core

Name: PDB 1AE9: Structure of the lambda integrase catalytic core
Published: 1997-11-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: dna recombination

Structure of the lambda integrase catalytic core. Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Nov 1997.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Enterobacteria phage lambda
Chains: 2
Atoms: 2,813
Mol. weight: 40.53 kDa
Released: 19 Nov 1997

Explore 1AE9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AE9 contains 24 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	182-191	10
α-helix	192-194	3
α-helix	197-209	13
α-helix	213-218	6
β-strand	220	1	1
α-helix	221-223	3
β-strand	224-225	2	2
β-strand	228-232	5	2
β-strand	239-243	5	2
β-strand	247-248	2	3
α-helix	249-251	3
β-strand	253-254	2	3
α-helix	255-261	7
α-helix	262-266	5
β-strand	270	1	1
α-helix	282-296	15
α-helix	304-305	2
α-helix	309-321	13
α-helix	324-331	8
β-strand	343-344	2	4
β-strand	349-350	2	4
β-strand	351-352	2	2

Chain B: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	182-191	10
α-helix	192-194	3
α-helix	197-209	13
α-helix	213-218	6
β-strand	220	1	5
α-helix	221-223	3
β-strand	224-225	2	6
β-strand	228-232	5	6
β-strand	239-243	5	6
β-strand	247-248	2	7
β-strand	253-254	2	7
α-helix	255-261	7
α-helix	262-266	5
β-strand	270	1	5
α-helix	278-280	3
α-helix	282-295	14
α-helix	304-305	2
α-helix	309-321	13
α-helix	324-331	8
β-strand	351-352	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lambda integrase	A, B	protein	179	Enterobacteria phage lambda	P03700

Sequence of entity 1 (A, B), FASTA

>1AE9_1 LAMBDA INTEGRASE (chains A, B)
RSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKT
GVKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKAS
GLSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHKSDTMASQFRDDRGREWDKIEI

Primary citation

Flexibility in DNA recombination: structure of the lambda integrase catalytic core. Kwon, H.J., Tirumalai, R., Landy, A. et al. Science (1997) 276:126-131. DOI 10.1126/science.276.5309.126 · PubMed

Other PDB entries of the same protein (UniProt P03700), best resolution first:

2OXO 2.0 Å, Crystallization and structure determination of the core-binding domain of bacteriophage…
1Z19 2.8 Å, Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
1P7D 2.95 Å, Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
1Z1B 3.8 Å, Crystal structure of a lambda integrase dimer bound to a COC' core site
1Z1G 4.4 Å, Crystal structure of a lambda integrase tetramer bound to a Holliday junction
5J0N 11.0 Å, Lambda excision HJ intermediate
1KJK Solution structure of the lambda integrase amino-terminal domain
2WCC phage lambda IntDBD1-64 complex with p prime 2 DNA

Browse structure collections

About this viewer

MolViewer shows 1AE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.