1P7D: Lambda Integrase

Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA. Determined by X-ray diffraction at 2.95 Å resolution. Released 12 Aug 2003.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Enterobacteria phage lambda
Chains: 6
Atoms: 5,884
Mol. weight: 87.8 kDa
Released: 12 Aug 2003

Explore 1P7D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P7D contains 34 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	76-87	12
α-helix	94-110	17
α-helix	121-133	13
α-helix	137-156	20
α-helix	169-172	4
α-helix	177-180	4
α-helix	182-191	10
α-helix	192-194	3
α-helix	197-209	13
α-helix	213-216	4
β-strand	220	1	1
α-helix	221-223	3
β-strand	224	1	2
β-strand	228-232	5	2
β-strand	239-243	5	2
β-strand	247-248	2	3
β-strand	253-254	2	3
α-helix	255-261	7
α-helix	262-266	5
β-strand	270	1	1
β-strand	273	1	4
β-strand	279	1	4
α-helix	282-296	15
α-helix	304-305	2
α-helix	309-321	13
α-helix	324-331	8
β-strand	351-352	2	5

Chain B: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	76-88	13
α-helix	94-110	17
α-helix	121-133	13
α-helix	137-156	20
α-helix	169-172	4
α-helix	177-179	3
α-helix	182-191	10
α-helix	192-194	3
α-helix	197-209	13
α-helix	213-216	4
β-strand	220	1	6
α-helix	221-223	3
β-strand	224	1	5
β-strand	228-232	5	5
β-strand	239-243	5	5
β-strand	247-248	2	7
β-strand	253-254	2	7
α-helix	255-261	7
α-helix	262-266	5
β-strand	270	1	6
β-strand	273	1	8
β-strand	279	1	8
α-helix	282-296	15
α-helix	304-305	2
α-helix	309-321	13
α-helix	324-331	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(cpapaptpgpcpcpapapcptptp*t)-3'	C, E	DNA	13
26-MER	D, F	DNA	26
Integrase	A, B	protein	283	Enterobacteria phage lambda	P03700

Sequence of entity 1 (C, E), FASTA

>1P7D_1 5'-D(*CP*AP*AP*TP*GP*CP*CP*AP*AP*CP*TP*TP*T)-3' (chains C, E)
CAATGCCAACTTT

Sequence of entity 2 (D, F), FASTA

>1P7D_2 26-MER (chains D, F)
TTTGCGAAGCAAAAAAGTTGGCATTG

Sequence of entity 3 (A, B), FASTA

>1P7D_3 Integrase (chains A, B)
MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYID
EGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSEVRRSRLTADEYLKIYQAAE
SSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTGVKIAIPTALHIDALGI
SMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFEGDPPTFHELRSL
SARLYEKQISDKFAQHLLGHKSDTMASQYRDDRGREWDKIEIK

Primary citation

A Conformational Switch Controls the DNA Cleavage Activity of Lambda Integrase. Aihara, H., Kwon, H.J., Nunes-Duby, S.E. et al. Mol Cell (2003) 12:187-198. DOI 10.1016/S1097-2765(03)00268-5 · PubMed

Other PDB entries of the same protein (UniProt P03700), best resolution first:

1AE9 1.9 Å, Structure of the lambda integrase catalytic core
2OXO 2.0 Å, Crystallization and structure determination of the core-binding domain of bacteriophage…
1Z19 2.8 Å, Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
1Z1B 3.8 Å, Crystal structure of a lambda integrase dimer bound to a COC' core site
1Z1G 4.4 Å, Crystal structure of a lambda integrase tetramer bound to a Holliday junction
5J0N 11.0 Å, Lambda excision HJ intermediate
1KJK Solution structure of the lambda integrase amino-terminal domain
2WCC phage lambda IntDBD1-64 complex with p prime 2 DNA

Browse structure collections

About this viewer

MolViewer shows 1P7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.