1KJK: Lambda integrase amino-terminal domain

Solution structure of the lambda integrase amino-terminal domain. Determined by solution NMR. Released 27 Mar 2002.

Method: Solution NMR
Organism: Enterobacteria phage lambda
Chains: 1
Atoms: 401
Mol. weight: 7.63 kDa
Released: 27 Mar 2002

Explore 1KJK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KJK contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	16-18	3	1
β-strand	24-27	4	1
β-strand	34-38	5	1
α-helix	41-57	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
integrase	A	protein	64	Enterobacteria phage lambda	P03700

Sequence of entity 1 (A), FASTA

>1KJK_1 integrase (chains A)
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHK
HKPL

Primary citation

Arm-site binding by lambda -integrase: solution structure and functional characterization of its amino-terminal domain. Wojciak, J.M., Sarkar, D., Landy, A. et al. Proc Natl Acad Sci U S A (2002) 99:3434-3439. DOI 10.1073/pnas.052017999 · PubMed

Other PDB entries of the same protein (UniProt P03700), best resolution first:

1AE9 1.9 Å, Structure of the lambda integrase catalytic core
2OXO 2.0 Å, Crystallization and structure determination of the core-binding domain of bacteriophage…
1Z19 2.8 Å, Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
1P7D 2.95 Å, Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
1Z1B 3.8 Å, Crystal structure of a lambda integrase dimer bound to a COC' core site
1Z1G 4.4 Å, Crystal structure of a lambda integrase tetramer bound to a Holliday junction
5J0N 11.0 Å, Lambda excision HJ intermediate
2WCC phage lambda IntDBD1-64 complex with p prime 2 DNA

Browse structure collections

About this viewer

MolViewer shows 1KJK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.