2WCC: Integrase

phage lambda IntDBD1-64 complex with p prime 2 DNA. Determined by solution NMR. Released 7 Apr 2009.

Method: Solution NMR
Organism: ENTEROBACTERIA PHAGE LAMBDA
Chains: 3
Atoms: 1,023
Mol. weight: 14.95 kDa
Released: 7 Apr 2009

Explore 2WCC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WCC contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 3: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	16-18	3	1
β-strand	24-27	4	1
β-strand	34-36	3	1
α-helix	41-55	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(dcpdgpdapdgpdtpdcpdap dapdapdapdtpdc)-3')	1	DNA	12	ENTEROBACTERIA PHAGE LAMBDA
DNA (5'-d(dgpdapdtpdtpdtpdtpdgp dapdcpdtpdgpdc)-3')	2	DNA	12	ENTEROBACTERIA PHAGE LAMBDA
Integrase	3	protein	64	ENTEROBACTERIA PHAGE LAMBDA	P03700

Sequence of entity 1 (1), FASTA

>2WCC_1 DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-3') (chains 1)
GCAGTCAAAATC

Sequence of entity 2 (2), FASTA

>2WCC_2 DNA (5'-D(*DGP*DAP*DTP*DTP*DTP*DTP*DGP *DAP*DCP*DTP*DGP*DC)-3') (chains 2)
GATTTTGACTGC

Sequence of entity 3 (3), FASTA

>2WCC_3 INTEGRASE (chains 3)
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHK
HKPL

Primary citation

NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove. Fadeev, E.A., Sam, M.D., Clubb, R.T. J Mol Biol (2009) 388:682. DOI 10.1016/J.JMB.2009.03.041 · PubMed

Other PDB entries of the same protein (UniProt P03700), best resolution first:

1AE9 1.9 Å, Structure of the lambda integrase catalytic core
2OXO 2.0 Å, Crystallization and structure determination of the core-binding domain of bacteriophage…
1Z19 2.8 Å, Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
1P7D 2.95 Å, Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
1Z1B 3.8 Å, Crystal structure of a lambda integrase dimer bound to a COC' core site
1Z1G 4.4 Å, Crystal structure of a lambda integrase tetramer bound to a Holliday junction
5J0N 11.0 Å, Lambda excision HJ intermediate
1KJK Solution structure of the lambda integrase amino-terminal domain

Browse structure collections

About this viewer

MolViewer shows 2WCC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.