2OXO: Integrase

Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Feb 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: unidentified phage
Chains: 1
Atoms: 811
Mol. weight: 11.54 kDa
Released: 26 Feb 2008

Explore 2OXO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OXO contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	75	1	1
α-helix	76-90	15
α-helix	94-110	17
β-strand	115	1	1
α-helix	116-118	3
α-helix	121-133	13
α-helix	137-156	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrase	A	protein	103	unidentified phage	P03700

Sequence of entity 1 (A), FASTA

>2OXO_1 Integrase (chains A)
MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYID
EGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSEVR

Primary citation

Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase. Kamadurai, H.B., Jain, R., Foster, M.P. Acta Crystallogr Sect F Struct Biol Cryst Commun (2008) 64:470-473. DOI 10.1107/S174430910801381X · PubMed

Other PDB entries of the same protein (UniProt P03700), best resolution first:

1AE9 1.9 Å, Structure of the lambda integrase catalytic core
1Z19 2.8 Å, Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
1P7D 2.95 Å, Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
1Z1B 3.8 Å, Crystal structure of a lambda integrase dimer bound to a COC' core site
1Z1G 4.4 Å, Crystal structure of a lambda integrase tetramer bound to a Holliday junction
5J0N 11.0 Å, Lambda excision HJ intermediate
1KJK Solution structure of the lambda integrase amino-terminal domain
2WCC phage lambda IntDBD1-64 complex with p prime 2 DNA

Browse structure collections

About this viewer

MolViewer shows 2OXO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.