1BQU: Cytokyne-binding region of GP130

Cytokyne-binding region of GP130. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Aug 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,695
Mol. weight: 50.3 kDa
Released: 26 Aug 1998

Explore 1BQU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BQU contains 24 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	7-11	5
β-strand	12-17	6	1
β-strand	18-19	2	2
β-strand	25-29	5	1
β-strand	39-46	8	3
β-strand	49-50	2	3
β-strand	54-55	2	3
α-helix	56-57	2
β-strand	63-65	3	1
α-helix	69-70	2
β-strand	76-84	9	3
β-strand	87-90	4	3
β-strand	94-96	3	3
α-helix	98-100	3
β-strand	102-103	2	2
α-helix	104-107	4
β-strand	108-113	6	4
β-strand	122-127	6	4
α-helix	130-133	4
β-strand	137-145	9	5
α-helix	151	1
β-strand	152-153	2	5
α-helix	156-159	4
β-strand	165-168	4	4
α-helix	171-172	2
β-strand	175-185	11	5
α-helix	192-198	7
β-strand	199-203	5	5
α-helix	207-213	7

Chain B: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
α-helix	7-11	5
β-strand	12-17	6	6
β-strand	18-19	2	7
β-strand	25-29	5	6
α-helix	38	1
β-strand	39-46	8	8
β-strand	49-50	2	8
α-helix	51-53	3
β-strand	54-55	2	8
β-strand	63-65	3	6
α-helix	69-70	2
β-strand	76-84	9	8
β-strand	87-90	4	8
β-strand	94-96	3	8
α-helix	98-100	3
β-strand	102-103	2	7
α-helix	104-107	4
β-strand	108-113	6	9
β-strand	122-127	6	9
α-helix	130-133	4
β-strand	137-145	9	10
β-strand	152-153	2	10
α-helix	156-158	3
β-strand	165-168	4	9
α-helix	171-172	2
β-strand	176-185	10	10
α-helix	192-195	4
β-strand	199-202	4	10
α-helix	203-205	3
α-helix	207-214	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (GP130)	A, B	protein	215	Homo sapiens	P40189 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1BQU_1 PROTEIN (GP130) (chains A, B)
PGSSGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDT
PTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSS
ILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFR
IRCMKEDGKGYWSDWSEEASGITYEDRPSKEPSFW

Primary citation

Crystal structure of a cytokine-binding region of gp130. Bravo, J., Staunton, D., Heath, J.K. et al. EMBO J (1998) 17:1665-1674. DOI 10.1093/emboj/17.6.1665 · PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5I 1.9 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
1I1R 2.4 Å, Crystal structure of a cytokine/receptor complex
1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
3L5H 3.6 Å, Crystal structure of the full ectodomain of human gp130: New insights into the molecular…

Browse structure collections

About this viewer

MolViewer shows 1BQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.