1I1R: Cytokine/receptor complex

Name: PDB 1I1R: Crystal structure of a cytokine/receptor complex
Published: 2001-03-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Crystal structure of a cytokine/receptor complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Mar 2001.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Human herpesvirus 8
Chains: 2
Atoms: 4,151
Mol. weight: 55.52 kDa
Released: 28 Mar 2001

Explore 1I1R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I1R contains 21 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	15-17	3	2
β-strand	22-28	7	1
α-helix	30-36	7
α-helix	40-42	3
β-strand	43-47	5	2
β-strand	50-51	2	2
α-helix	52-53	2
α-helix	54-56	3
β-strand	58-61	4	1
β-strand	64-69	6	1
β-strand	76-85	10	2
β-strand	89-101	13	2
α-helix	103-107	5
β-strand	108-113	6	3
β-strand	114-115	2	4
β-strand	121-125	5	3
β-strand	135-142	8	5
β-strand	145-146	2	5
α-helix	147-149	3
β-strand	150-151	2	5
α-helix	152-153	2
β-strand	159-161	3	3
β-strand	172-180	9	5
β-strand	183-186	4	5
β-strand	190-192	3	5
α-helix	194-197	4
β-strand	198-199	2	4
α-helix	200-203	4
β-strand	204-209	6	6
β-strand	218-223	6	6
α-helix	226-229	4
β-strand	233-241	9	7
β-strand	248-249	2	7
α-helix	252-255	4
β-strand	261-264	4	6
α-helix	267-268	2
β-strand	272-281	10	7
α-helix	288-291	4
β-strand	295-298	4	7
α-helix	299-301	3

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-34	26
β-strand	37	1	8
β-strand	41	1	8
α-helix	67-92	26
α-helix	99-101	3
α-helix	102-120	19
α-helix	124-125	2
α-helix	132-138	7
α-helix	145-169	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6 receptor beta chain	A	protein	303	Homo sapiens	P40189 (AlphaFold model)
Viral il-6	B	protein	181	Human herpesvirus 8	Q98823

Sequence of entity 1 (A), FASTA

>1I1R_1 INTERLEUKIN-6 RECEPTOR BETA CHAIN (chains A)
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTII
NRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKM
RCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAEN
ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYR
TKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITY
EDR

Sequence of entity 2 (B), FASTA

>1I1R_2 VIRAL IL-6 (chains B)
LPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHC
GLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKL
TKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLDSIPDVTPDVHD
K

Primary citation

Structure of an extracellular gp130 cytokine receptor signaling complex. Chow, D., He, X., Snow, A.L. et al. Science (2001) 291:2150-2150. DOI 10.1126/science.1058308 · PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5I 1.9 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
1BQU 2.0 Å, Cytokyne-binding region of GP130
1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
3L5H 3.6 Å, Crystal structure of the full ectodomain of human gp130: New insights into the molecular…

Browse structure collections

About this viewer

MolViewer shows 1I1R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.