1II6: Mitotic Kinesin Eg5

Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Jul 2001.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,704
Mol. weight: 83.14 kDa
Ligands: ADP, MG
Released: 18 Jul 2001

Explore 1II6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1II6 contains 37 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	1
α-helix	30-34	5
β-strand	39	1	2
β-strand	41-44	4	3
β-strand	49-53	5	3
β-strand	63-67	5	3
β-strand	70-72	3	1
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	1
α-helix	111-115	5
β-strand	117	1	4
α-helix	129-130	2
β-strand	133	1	4
α-helix	135-149	15
β-strand	153-164	12	1
β-strand	167-170	4	1
β-strand	183-185	3	5
α-helix	186-187	2
β-strand	195-197	3	5
β-strand	202-204	3	1
α-helix	207-209	3
α-helix	210-226	17
α-helix	232-234	3
β-strand	236-247	12	1
β-strand	255-265	11	1
α-helix	266-268	3
α-helix	282-304	23
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-324	4
β-strand	330-336	7	1
β-strand	339	1	2
α-helix	340-342	3
α-helix	343-356	14
α-helix	360-362	3

Chain B: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	6
α-helix	26-28	3
α-helix	30-34	5
α-helix	37-38	2
β-strand	39	1	7
β-strand	41-44	4	8
β-strand	49-53	5	8
β-strand	63-67	5	8
β-strand	70-72	3	6
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	6
α-helix	111-115	5
β-strand	117	1	9
β-strand	133	1	9
α-helix	135-149	15
β-strand	153-164	12	6
β-strand	167-170	4	6
β-strand	184-187	4	10
β-strand	190-196	7	10
β-strand	202-204	3	6
α-helix	209-228	20
α-helix	232-234	3
β-strand	236-247	12	6
β-strand	255-265	11	6
α-helix	266-268	3
α-helix	269-271	3
α-helix	291-303	13
α-helix	311-313	3
α-helix	315-319	5
β-strand	330-336	7	6
β-strand	339	1	7
α-helix	340-342	3
α-helix	343-356	14
α-helix	360-363	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-related motor protein Eg5	A, B	protein	368	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1II6_1 KINESIN-RELATED MOTOR PROTEIN Eg5 (chains A, B)
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (NO3) are not listed.

Primary citation

Crystal structure of the mitotic spindle kinesin Eg5 reveals a novel conformation of the neck-linker. Turner, J., Anderson, R., Guo, J. et al. J Biol Chem (2001) 276:25496-25502. DOI 10.1074/jbc.M100395200 · PubMed

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1

Browse structure collections

About this viewer

MolViewer shows 1II6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.