6G6Y: Eg5-inhibitor complex

Eg5-inhibitor complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,802
Mol. weight: 41.94 kDa
Ligands: EOK, MG, ADP
Released: 8 Aug 2018

Explore 6G6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6G6Y contains 19 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
α-helix	19	1
β-strand	20-25	6	2
α-helix	26-28	3
α-helix	30-34	5
β-strand	39	1	3
β-strand	41-44	4	4
β-strand	49-53	5	4
β-strand	63-67	5	4
β-strand	70-72	3	2
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	2
α-helix	111-115	5
β-strand	117	1	5
α-helix	119-120	2
α-helix	127-129	3
β-strand	133	1	5
α-helix	135-147	13
β-strand	153-164	12	2
β-strand	167-170	4	2
β-strand	183-186	4	6
β-strand	194-197	4	6
β-strand	202-203	2	2
α-helix	207-226	20
α-helix	231-234	4
β-strand	236-247	12	2
β-strand	255-265	11	2
α-helix	266-268	3
α-helix	290-303	14
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	329-336	8	2
β-strand	339	1	3
α-helix	340-342	3
α-helix	343-356	14
β-strand	360	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF11	A	protein	370	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6G6Y_1 Kinesin-like protein KIF11 (chains A)
GPMASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLA
DKSSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGE
RSPNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDV
SERLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSV
FSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRV
ITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKN
ILNKPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
EOK	(~{N}~{Z})-~{N}-[(5~{S})-4-ethanoyl-5-methyl-5-phenyl-1,3,4-thiadiazolidin-2-yl…	C13 H15 N3 O2 S	1
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Crystal structure of the Eg5 - K858 complex and implications for structure-based design of thiadiazole-containing inhibitors. Talapatra, S.K., Tham, C.L., Guglielmi, P. et al. Eur J Med Chem (2018) 156:641-651. DOI 10.1016/j.ejmech.2018.07.006 · PubMed

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 6G6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.