1X88: Human Eg5 motor domain

Human Eg5 motor domain bound to Mg-ADP and monastrol. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Nov 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,030
Mol. weight: 81.85 kDa
Ligands: NAT, ADP, MG
Released: 15 Nov 2005

Explore 1X88 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X88 contains 42 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
α-helix	26-29	4
α-helix	30-34	5
β-strand	41-44	4	2
β-strand	49-57	9	2
β-strand	60-67	8	2
β-strand	70-72	3	1
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	1
α-helix	111-115	5
β-strand	117	1	3
α-helix	119-120	2
α-helix	121-123	3
α-helix	127-129	3
β-strand	133	1	3
α-helix	135-146	12
β-strand	152-164	13	1
β-strand	167-170	4	1
α-helix	180-181	2
β-strand	182	1	1
β-strand	183-187	5	4
β-strand	190-197	8	4
β-strand	202-204	3	1
α-helix	207-209	3
α-helix	210-227	18
α-helix	231-234	4
β-strand	236-248	13	1
β-strand	254-265	12	1
α-helix	266-268	3
α-helix	290-303	14
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	329-336	8	1
α-helix	340-342	3
α-helix	343-356	14

Chain B: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	5
α-helix	19	1
β-strand	20-25	6	6
α-helix	26-28	3
α-helix	30-34	5
β-strand	41-44	4	7
β-strand	49-53	5	7
β-strand	63-67	5	7
β-strand	70-72	3	6
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	6
α-helix	111-115	5
β-strand	117	1	8
α-helix	119-120	2
α-helix	121-123	3
α-helix	127-129	3
β-strand	133	1	8
α-helix	135-147	13
β-strand	152-164	13	6
β-strand	167-170	4	6
β-strand	182	1	6
β-strand	183-186	4	9
β-strand	194-197	4	9
β-strand	202-204	3	6
α-helix	207-209	3
α-helix	210-227	18
α-helix	231-234	4
β-strand	236-248	13	6
β-strand	254-265	12	6
α-helix	266-268	3
α-helix	290-303	14
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	329-336	8	6
α-helix	340-342	3
α-helix	343-356	14
β-strand	360	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF11	A, B	protein	359	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1X88_1 Kinesin-like protein KIF11 (chains A, B)
KKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFD
MVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEE
DPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPR
NKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETT
IDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERTPHV
PYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNILNKPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
NAT	Ethyl 4-(3-hydroxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carb…	C14 H16 N2 O3 S	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Structural Basis of Eg5 Inhibition by Monastrol. Maliga, Z., Mitchison, T.J. To be published.

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 1X88 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.