5JV3: PDB entry 5JV3

The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1. Determined by X-ray diffraction at 2.01 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,477
Mol. weight: 35.86 kDa
Ligands: CA
Released: 3 Aug 2016

Explore 5JV3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JV3 contains 12 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-49	41
α-helix	56-65	10

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-49	41
α-helix	51-53	3
α-helix	56-65	10
β-strand	67	1	1
β-strand	73	1	1

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-6	3
α-helix	8-49	42
α-helix	56-65	10

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-7	4
α-helix	8-49	42
α-helix	51-53	3
α-helix	56-65	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family…	A, B, C, D	protein	76	Homo sapiens	P52732 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5JV3_1 Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1 (chains A, B, C, D)
LSNQKLTKKALIKEYTEEIERLKRDLAALEKERDFYFGKLRNIELICQENEGENDPVLQR
IVDILYATDEGFVIPD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 5JV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.