The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1. Determined by X-ray diffraction at 2.01 Å resolution. Released 3 Aug 2016.
Explore 5JV3 in 3D Show helices and sheets RCSB PDB PDBe
5JV3 contains 12 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-49 | 41 | |
| α-helix | 56-65 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-49 | 41 | |
| α-helix | 51-53 | 3 | |
| α-helix | 56-65 | 10 | |
| β-strand | 67 | 1 | 1 |
| β-strand | 73 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 8-49 | 42 | |
| α-helix | 56-65 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-7 | 4 | |
| α-helix | 8-49 | 42 | |
| α-helix | 51-53 | 3 | |
| α-helix | 56-65 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family… | A, B, C, D | protein | 76 | Homo sapiens | P52732 (AlphaFold model), Q15691 (AlphaFold model) |
>5JV3_1 Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1 (chains A, B, C, D) LSNQKLTKKALIKEYTEEIERLKRDLAALEKERDFYFGKLRNIELICQENEGENDPVLQR IVDILYATDEGFVIPD
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed
Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.