8YHH: Mitotic Kinesin Eg5 from Biortus

The Crystal Structure of Mitotic Kinesin Eg5 from Biortus. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,469
Mol. weight: 84.09 kDa
Ligands: MG, ADP
Released: 13 Mar 2024

Explore 8YHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YHH contains 41 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	1
α-helix	26-28	3
α-helix	30-34	5
α-helix	37-38	2
β-strand	39	1	2
β-strand	41-44	4	3
β-strand	49-53	5	3
β-strand	63-67	5	3
β-strand	70-72	3	1
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	1
α-helix	111-115	5
β-strand	117	1	4
β-strand	133	1	4
α-helix	135-149	15
β-strand	153-164	12	1
β-strand	167-170	4	1
α-helix	180-181	2
β-strand	182	1	1
β-strand	183-187	5	5
β-strand	190-197	8	5
β-strand	202-204	3	1
α-helix	207-209	3
α-helix	210-228	19
α-helix	232-234	3
β-strand	236-248	13	1
β-strand	254-265	12	1
α-helix	266-268	3
α-helix	269-271	3
α-helix	290-304	15
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	330-336	7	1
β-strand	339	1	2
α-helix	340-342	3
α-helix	343-356	14
β-strand	359	1	3
α-helix	360-363	4

Chain B: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	6
α-helix	26-28	3
α-helix	30-34	5
α-helix	37-38	2
β-strand	39	1	7
β-strand	41-44	4	8
β-strand	49-53	5	8
α-helix	60-62	3
β-strand	63-67	5	8
β-strand	70-72	3	6
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	6
α-helix	111-115	5
β-strand	117	1	9
β-strand	133	1	9
α-helix	135-149	15
β-strand	153-164	12	6
β-strand	167-170	4	6
α-helix	181-182	2
β-strand	183-187	5	10
β-strand	190-197	8	10
β-strand	202-204	3	6
α-helix	210-228	19
α-helix	232-234	3
β-strand	236-246	11	6
β-strand	256-265	10	6
α-helix	266-268	3
α-helix	290-304	15
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	330-336	7	6
β-strand	339	1	7
α-helix	340-342	3
α-helix	343-356	14
α-helix	360-363	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF11	A, B	protein	370	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8YHH_1 Kinesin-like protein KIF11 (chains A, B)
GGMASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLA
DKSSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGE
RSPNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDV
SERLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSV
FSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRV
ITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKN
ILNKPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Water and common crystallization additives (NO3, GOL, MES, EDO) are not listed.

Primary citation

The Crystal Structure of Mitotic Kinesin Eg5 from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 8YHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.