3K5E: Human kinesin-like motor protein Kif11/KSP/Eg5

The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and enastrol. Determined by X-ray diffraction at 1.97 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,701
Mol. weight: 83.57 kDa
Ligands: K5E, ADP, MG
Released: 20 Oct 2009

Explore 3K5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K5E contains 39 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
α-helix	30-33	4
β-strand	41-44	4	2
β-strand	49-53	5	2
β-strand	63-67	5	2
β-strand	70-72	3	1
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-95	9
β-strand	98-105	8	1
α-helix	111-115	5
β-strand	117	1	3
α-helix	119-120	2
β-strand	133	1	3
α-helix	135-149	15
β-strand	152-164	13	1
β-strand	167-170	4	1
α-helix	181	1
β-strand	182	1	1
β-strand	183-186	4	4
β-strand	194-197	4	4
β-strand	202-204	3	1
α-helix	207-209	3
α-helix	210-227	18
α-helix	231-234	4
β-strand	236-248	13	1
β-strand	254-265	12	1
α-helix	266-268	3
α-helix	290-303	14
α-helix	311-313	3
α-helix	315-320	6
α-helix	321-323	3
β-strand	329-336	8	1
α-helix	340-342	3
α-helix	343-356	14

Chain B: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	5
α-helix	26-29	4
α-helix	30-33	4
α-helix	37-38	2
β-strand	39	1	6
β-strand	41-44	4	7
β-strand	49-53	5	7
β-strand	63-67	5	7
β-strand	70-72	3	5
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	5
α-helix	111-115	5
β-strand	117	1	8
α-helix	119-120	2
α-helix	121-123	3
α-helix	127-129	3
β-strand	133	1	8
α-helix	135-146	12
β-strand	152-164	13	5
β-strand	167-170	4	5
β-strand	182	1	5
β-strand	183-186	4	9
β-strand	194-197	4	9
β-strand	202-204	3	5
α-helix	207-209	3
α-helix	210-227	18
α-helix	231-234	4
β-strand	236-248	13	5
β-strand	254-265	12	5
α-helix	266-268	3
α-helix	290-303	14
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-323	3
β-strand	329-336	8	5
β-strand	339	1	6
α-helix	340-342	3
α-helix	343-356	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF11	A, B	protein	368	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3K5E_1 Kinesin-like protein KIF11 (chains A, B)
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
K5E	(4S,5R)-5-hydroxy-4-(3-hydroxyphenyl)-3,4,5,6,7,8-hexahydroquinazoline-2(1H)-th…	C14 H16 N2 O2 S	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Primary citation

The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and enastrol. Crawley, L., Cheng, R.K.Y., Wood, M. et al. To be published.

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
6TLE 1.75 Å, Human Eg5 motor domain mutant E344K
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 3K5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.