6TLE: Human Eg5 motor domain mutant E344K

Human Eg5 motor domain mutant E344K. Determined by X-ray diffraction at 1.75 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,890
Mol. weight: 82.81 kDa
Ligands: ADP, MG
Released: 30 Jun 2021

Explore 6TLE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TLE contains 35 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	1
α-helix	26-28	3
α-helix	30-34	5
β-strand	39	1	2
β-strand	41-44	4	3
β-strand	49-53	5	3
β-strand	63-67	5	3
β-strand	70-72	3	1
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	1
α-helix	111-115	5
β-strand	117	1	4
β-strand	133	1	4
α-helix	135-149	15
β-strand	153-164	12	1
β-strand	167-170	4	1
α-helix	181-182	2
β-strand	184-187	4	5
β-strand	190-196	7	5
β-strand	202-204	3	1
α-helix	209-228	20
α-helix	232-234	3
β-strand	236-248	13	1
α-helix	253	1
β-strand	254-265	12	1
α-helix	266-268	3
α-helix	284-304	21
α-helix	311-313	3
α-helix	315-324	10
β-strand	330-336	7	1
β-strand	339	1	2
α-helix	340-342	3
α-helix	343-356	14
α-helix	360-362	3

Chain B: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	6
α-helix	26-27	2
β-strand	41-44	4	7
β-strand	49-53	5	7
β-strand	63-67	5	7
β-strand	70-72	3	6
α-helix	78-81	4
α-helix	82-86	5
α-helix	87-94	8
β-strand	98-105	8	6
α-helix	111-115	5
β-strand	117	1	8
β-strand	133	1	8
α-helix	135-149	15
β-strand	153-164	12	6
β-strand	167-170	4	6
α-helix	181	1
β-strand	182	1	6
β-strand	184-186	3	9
β-strand	194-196	3	9
β-strand	202-204	3	6
α-helix	209-228	20
α-helix	232-234	3
β-strand	236-248	13	6
β-strand	254-265	12	6
α-helix	266-268	3
α-helix	284-304	21
α-helix	311-313	3
α-helix	315-319	5
α-helix	321-324	4
β-strand	330-336	7	6
α-helix	340-342	3
α-helix	343-356	14
α-helix	360-362	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF11	A, B	protein	367	Homo sapiens	P52732 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TLE_1 Kinesin-like protein KIF11 (chains A, B)
ASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKS
SRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSP
NEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSER
LQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFSV
TIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITA
LVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLKETLSTLEYAHRAKNILN
KPEVNQK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (NO3) are not listed.

Primary citation

Human Eg5 motor domain mutant E344K. Garcia-Saez, I., Skoufias, D.A. To be published.

Other PDB entries of the same protein (UniProt P52732 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZCW 1.69 Å, Eg5 - New allosteric binding site
1X88 1.8 Å, Human Eg5 motor domain bound to Mg-ADP and monastrol
6G6Y 1.8 Å, Eg5-inhibitor complex
2PG2 1.85 Å, Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
1Q0B 1.9 Å, Crystal structure of the motor protein KSP in complex with ADP and monastrol
2X7C 1.9 Å, Crystal structure of human kinesin Eg5 in complex with (S)-enastron
8YHH 1.95 Å, The Crystal Structure of Mitotic Kinesin Eg5 from Biortus
3K5E 1.97 Å, The structure of human kinesin-like motor protein Kif11/KSP/Eg5 in complex with ADP and…
2WOG 2.0 Å, Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine
3L9H 2.0 Å, X-ray structure of mitotic kinesin-5 (KSP, KIF11, Eg5)in complex with the…
5JV3 2.01 Å, The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
1II6 2.1 Å, Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.

Browse structure collections

About this viewer

MolViewer shows 6TLE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.