1LCJ: P56==LCK== tyrosine kinase

SH2 (src homology-2) domain of human P56-lck tyrosine kinase complexed with the 11 residue phosphotyrosyl peptide epqpyeeipiyl. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Oct 1995.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,002
Mol. weight: 13.86 kDa
Released: 15 Oct 1995

Explore 1LCJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LCJ contains 3 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	128	1	1
α-helix	134-141	8
β-strand	151-155	5	1
β-strand	163-171	9	1
β-strand	175-183	9	1
β-strand	184-186	3	2
β-strand	190-192	3	2
β-strand	199	1	2
α-helix	202-211	10
β-strand	223	1	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	205	1	1
α-helix	207-210	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
P56==LCK== tyrosine kinase	A	protein	109	Homo sapiens	P06239 (AlphaFold model)
Phosphopeptide epq(phospho)yeeipiyl	B	protein	11		P03079

Sequence of entity 1 (A), FASTA

>1LCJ_1 P56==LCK== TYROSINE KINASE (chains A)
MANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEV
VKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQT

Sequence of entity 2 (B), FASTA

>1LCJ_2 PHOSPHOPEPTIDE EPQ(PHOSPHO)YEEIPIYL (chains B)
EPQYEEIPIYL

Primary citation

Recognition of a high-affinity phosphotyrosyl peptide by the Src homology-2 domain of p56lck. Eck, M.J., Shoelson, S.E., Harrison, S.C. Nature (1993) 362:87-91. DOI 10.1038/362087a0 · PubMed

Other PDB entries of the same protein (UniProt P06239 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LKK 1.0 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
2IIM 1.0 Å, SH3 Domain of Human Lck
8X2P 1.4 Å, The Crystal Structure of LCK from Biortus.
1QPC 1.6 Å, Structural analysis of the lymphocyte-specific kinase lck in complex with non-selective…
3LCK 1.7 Å, The kinase domain of human lymphocyte kinase (LCK), activated form (auto-phosphorylated…
4C3F 1.72 Å, Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
1BHF 1.8 Å, P56LCK SH2 domain inhibitor complex
1LKL 1.8 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
6PDJ 1.81 Å, Tyrosine-protein kinase LCK bound to Compound 11
1BHH 1.9 Å, Free P56LCK SH2 domain
3MPM 1.95 Å, LCK complexed with a pyrazolopyrimidine
3AC1 1.99 Å, Crystal structure of pyrazin derivative bound to the kinase domain of Human LCK,…

Browse structure collections

About this viewer

MolViewer shows 1LCJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.