1LKK: Human P56-lck tyrosine kinase SH2 domain

Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide ac-ptyr-glu-glu-ile (pyeei peptide). Determined by X-ray diffraction at 1.0 Å resolution. Released 8 Mar 1996.

Method: X-ray diffraction
Resolution: 1.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,103
Mol. weight: 12.69 kDa
Ligands: ACE
Released: 8 Mar 1996

Explore 1LKK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LKK contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	128	1	1
α-helix	134-141	8
β-strand	151-155	5	1
β-strand	163-171	9	1
β-strand	175-183	9	1
β-strand	184-185	2	2
α-helix	186	1
β-strand	191-192	2	2
β-strand	199	1	2
α-helix	202-211	10
β-strand	223	1	1
α-helix	224-225	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	253	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human P56 tyrosine kinase	A	protein	105	Homo sapiens	P06239 (AlphaFold model)
Phosphotyrosyl peptide ac-ptyr-glu-glu-ile	B	protein	5

Sequence of entity 1 (A), FASTA

>1LKK_1 HUMAN P56 TYROSINE KINASE (chains A)
LEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHY
KIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQT

Sequence of entity 2 (B), FASTA

>1LKK_2 PHOSPHOTYROSYL PEPTIDE AC-PTYR-GLU-GLU-ILE (chains B)
XYEEI

Ligands and cofactors

ID	Name	Formula	Copies
ACE	Acetyl group	C2 H4 O	1

Primary citation

Crystal structures of the human p56lck SH2 domain in complex with two short phosphotyrosyl peptides at 1.0 A and 1.8 A resolution. Tong, L., Warren, T.C., King, J. et al. J Mol Biol (1996) 256:601-610. DOI 10.1006/jmbi.1996.0112 · PubMed

Other PDB entries of the same protein (UniProt P06239 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IIM 1.0 Å, SH3 Domain of Human Lck
8X2P 1.4 Å, The Crystal Structure of LCK from Biortus.
1QPC 1.6 Å, Structural analysis of the lymphocyte-specific kinase lck in complex with non-selective…
3LCK 1.7 Å, The kinase domain of human lymphocyte kinase (LCK), activated form (auto-phosphorylated…
4C3F 1.72 Å, Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
1BHF 1.8 Å, P56LCK SH2 domain inhibitor complex
1LCJ 1.8 Å, SH2 (src homology-2) domain of human P56-lck tyrosine kinase complexed with the 11…
1LKL 1.8 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
6PDJ 1.81 Å, Tyrosine-protein kinase LCK bound to Compound 11
1BHH 1.9 Å, Free P56LCK SH2 domain
3MPM 1.95 Å, LCK complexed with a pyrazolopyrimidine
3AC1 1.99 Å, Crystal structure of pyrazin derivative bound to the kinase domain of Human LCK,…

Browse structure collections

About this viewer

MolViewer shows 1LKK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.