3MPM: LCK

LCK complexed with a pyrazolopyrimidine. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,381
Mol. weight: 31.12 kDa
Ligands: 5LK
Released: 2 Jun 2010

Explore 3MPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MPM contains 19 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	239	1	1
α-helix	242-244	3
β-strand	245-254	10	1
β-strand	257-264	8	1
β-strand	268-275	8	1
α-helix	276	1
α-helix	282-294	13
β-strand	300	1	2
α-helix	301-302	2
β-strand	303-307	5	1
α-helix	312	1
β-strand	313-317	5	1
β-strand	323	1	2
α-helix	324-327	4
α-helix	331-334	4
α-helix	338-357	20
α-helix	367-369	3
β-strand	370-372	3	2
β-strand	378-380	3	2
α-helix	404-406	3
α-helix	409-414	6
α-helix	419-434	16
α-helix	438-439	2
α-helix	446-454	9
α-helix	459-462	4
α-helix	467-476	10
α-helix	481-483	3
α-helix	485-486	2
α-helix	487-495	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase Lck	A	protein	267	Homo sapiens	P06239 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MPM_1 Tyrosine-protein kinase Lck (chains A)
GPEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQ
LQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAF
IEERNYIHRNLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINY
GTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMR
LCWKERPEDRPTFDYLRSVLEDFFTAT

Ligands and cofactors

ID	Name	Formula	Copies
5LK	4-{(6R,7R)-7-amino-3-[3-(4-methylpiperazin-1-yl)phenyl]-6,7-dihydropyrazolo[1,5…	C23 H26 N6 O	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

New pyrazolo[1,5a]pyrimidines as orally active inhibitors of Lck. Gommermann, N., Buehlmayer, P., von Matt, A. et al. Bioorg Med Chem Lett (2010) 20:3628-3631. DOI 10.1016/j.bmcl.2010.04.112 · PubMed

Other PDB entries of the same protein (UniProt P06239 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LKK 1.0 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
2IIM 1.0 Å, SH3 Domain of Human Lck
8X2P 1.4 Å, The Crystal Structure of LCK from Biortus.
1QPC 1.6 Å, Structural analysis of the lymphocyte-specific kinase lck in complex with non-selective…
3LCK 1.7 Å, The kinase domain of human lymphocyte kinase (LCK), activated form (auto-phosphorylated…
4C3F 1.72 Å, Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
1BHF 1.8 Å, P56LCK SH2 domain inhibitor complex
1LCJ 1.8 Å, SH2 (src homology-2) domain of human P56-lck tyrosine kinase complexed with the 11…
1LKL 1.8 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
6PDJ 1.81 Å, Tyrosine-protein kinase LCK bound to Compound 11
1BHH 1.9 Å, Free P56LCK SH2 domain
3AC1 1.99 Å, Crystal structure of pyrazin derivative bound to the kinase domain of Human LCK,…

Browse structure collections

About this viewer

MolViewer shows 3MPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.