8X2P: LCK from Biortus

The Crystal Structure of LCK from Biortus. Determined by X-ray diffraction at 1.4 Å resolution. Released 22 Nov 2023.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,000
Mol. weight: 25.02 kDa
Released: 22 Nov 2023

Explore 8X2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X2P contains 6 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	128-129	2	1
α-helix	134-142	9
β-strand	151-155	5	1
β-strand	163-169	7	1
β-strand	177-183	7	1
β-strand	184-185	2	2
α-helix	186	1
β-strand	191-192	2	2
β-strand	198-199	2	2
α-helix	202-211	10
β-strand	223	1	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	128-129	2	3
α-helix	134-142	9
β-strand	151-155	5	3
β-strand	163-170	8	3
β-strand	176-183	8	3
β-strand	184-185	2	4
β-strand	191-192	2	4
β-strand	199	1	4
α-helix	202-211	10
β-strand	223	1	3
α-helix	224-225	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase Lck	A, B	protein	108	Homo sapiens	P06239 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8X2P_1 Tyrosine-protein kinase Lck (chains A, B)
ANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVV
KHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQT

Primary citation

The Crystal Structure of LCK from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P06239 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LKK 1.0 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
2IIM 1.0 Å, SH3 Domain of Human Lck
1QPC 1.6 Å, Structural analysis of the lymphocyte-specific kinase lck in complex with non-selective…
3LCK 1.7 Å, The kinase domain of human lymphocyte kinase (LCK), activated form (auto-phosphorylated…
4C3F 1.72 Å, Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
1BHF 1.8 Å, P56LCK SH2 domain inhibitor complex
1LCJ 1.8 Å, SH2 (src homology-2) domain of human P56-lck tyrosine kinase complexed with the 11…
1LKL 1.8 Å, Human P56-lck tyrosine kinase SH2 domain in complex with the phosphotyrosyl peptide…
6PDJ 1.81 Å, Tyrosine-protein kinase LCK bound to Compound 11
1BHH 1.9 Å, Free P56LCK SH2 domain
3MPM 1.95 Å, LCK complexed with a pyrazolopyrimidine
3AC1 1.99 Å, Crystal structure of pyrazin derivative bound to the kinase domain of Human LCK,…

Browse structure collections

About this viewer

MolViewer shows 8X2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.