1M3V: PDB entry 1M3V

FLIN4: Fusion of the LIM binding domain of Ldb1 and the N-terminal LIM domain of LMO4. Determined by solution NMR. Released 13 May 2003.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 907
Mol. weight: 13.15 kDa
Ligands: ZN
Released: 13 May 2003

Explore 1M3V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M3V contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	21-23	3	1
β-strand	26-28	3	1
α-helix	30-33	4
β-strand	46-47	2	2
β-strand	50-52	3	3
β-strand	55-57	3	3
α-helix	59-66	8
β-strand	82-83	2	2
β-strand	106-107	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
fusion of the LIM interacting domain of ldb1 and the N-terminal LIM domain of LMO4	A	protein	122	Mus musculus	P70662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M3V_1 fusion of the LIM interacting domain of ldb1 and the N-terminal LIM domain of LMO4 (chains A)
GSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSSCQAQLGDIGTSSYTKSGMILCRN
DYIRLFGNSGAGGSGGHMGSGGDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGID
DE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for the recognition of ldb1 by the N-terminal LIM domains of LMO2 and LMO4. Deane, J.E., Mackay, J.P., Kwan, A.H. et al. EMBO J (2003) 22:2224-2233. DOI 10.1093/emboj/cdg196 · PubMed

Other PDB entries of the same protein (UniProt P70662 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RUT 1.3 Å, Complex of LMO4 LIM domains 1 and 2 with the ldb1 LID domain
6PTL 2.5 Å, Structure of the self-association domain of the chromatin looping factor LDB1
4JCJ 3.0 Å, Crystal structure of Isl1 LIM domains with Ldb1 LIM-interaction domain
1J2O Structure of FLIN2, a complex containing the N-terminal LIM domain of LMO2 and ldb1-LID
2JTN NMR Solution Structure of a ldb1-LID:Lhx3-LIM complex
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG
2LXD Backbone 1H, 13C, and 15N Chemical Shift Assignments for LMO2(LIM2)-Ldb1(LID)

Browse structure collections

About this viewer

MolViewer shows 1M3V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.