Structure of the self-association domain of the chromatin looping factor LDB1. Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Jul 2020.
Explore 6PTL in 3D Show helices and sheets RCSB PDB PDBe
6PTL contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-41 | 10 | |
| α-helix | 42-44 | 3 | |
| α-helix | 51-61 | 11 | |
| β-strand | 62-71 | 10 | 1 |
| β-strand | 80-84 | 5 | 1 |
| α-helix | 85-87 | 3 | |
| α-helix | 88-97 | 10 | |
| β-strand | 102-108 | 7 | 1 |
| α-helix | 110 | 1 | |
| β-strand | 111-114 | 4 | 1 |
| β-strand | 118-131 | 14 | 1 |
| β-strand | 139-151 | 13 | 1 |
| β-strand | 158-171 | 14 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LIM domain-binding protein 1 | A | protein | 192 | Mus musculus | P70662 (AlphaFold model) |
>6PTL_1 LIM domain-binding protein 1 (chains A) GELGSPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAML TITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSM VTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLD QLSKNITRCGLS
Structure of the self-association domain of the chromatin looping factor LDB1. Macindoe, I., Silva, A., Guss, J.M. et al. To be published.
Other PDB entries of the same protein (UniProt P70662 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6PTL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.