2JTN: Ldb1-LID:Lhx3-LIM complex

NMR Solution Structure of a ldb1-LID:Lhx3-LIM complex. Determined by solution NMR. Released 17 Jun 2008.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,413
Mol. weight: 20.52 kDa
Ligands: ZN
Released: 17 Jun 2008

Explore 2JTN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JTN contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	1
β-strand	29-32	4	2
α-helix	61	1
β-strand	62	1	3
α-helix	63	1
β-strand	64	1	2
β-strand	69	1	3
β-strand	74-78	5	2
β-strand	81-83	3	2
β-strand	102-104	3	4
β-strand	107-109	3	4
α-helix	111-116	6
β-strand	137-138	2	5
β-strand	141-142	2	5
β-strand	162-163	2	1
β-strand	164-165	2	6
β-strand	171-172	2	6
α-helix	174-180	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LIM domain-binding protein 1, LIM/homeobox protein Lhx3	A	protein	182	Mus musculus	P70662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JTN_1 LIM domain-binding protein 1, LIM/homeobox protein Lhx3 (chains A)
SSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEGGSGGHMGSGGTPEI
PMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGT
KCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETA
KQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. Bhati, M., Lee, C., Nancarrow, A.L. et al. EMBO J (2008) 27:2018-2029. DOI 10.1038/emboj.2008.123 · PubMed

Other PDB entries of the same protein (UniProt P70662 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RUT 1.3 Å, Complex of LMO4 LIM domains 1 and 2 with the ldb1 LID domain
6PTL 2.5 Å, Structure of the self-association domain of the chromatin looping factor LDB1
4JCJ 3.0 Å, Crystal structure of Isl1 LIM domains with Ldb1 LIM-interaction domain
1J2O Structure of FLIN2, a complex containing the N-terminal LIM domain of LMO2 and ldb1-LID
1M3V FLIN4: Fusion of the LIM binding domain of Ldb1 and the N-terminal LIM domain of LMO4
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG
2LXD Backbone 1H, 13C, and 15N Chemical Shift Assignments for LMO2(LIM2)-Ldb1(LID)

Browse structure collections

About this viewer

MolViewer shows 2JTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.