1P7H: PDB entry 1P7H

Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 8
Atoms: 10,395
Mol. weight: 148.3 kDa
Released: 23 Sept 2003

Explore 1P7H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P7H contains 30 α-helices and 118 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains L and N: 8 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	1
β-strand	404-405	2	2
β-strand	408-409	2	2
β-strand	410-414	5	3
α-helix	415-417	3
β-strand	419	1	4
β-strand	423	1	5
β-strand	432	1	5
β-strand	442-445	4	3
β-strand	454-461	8	1
α-helix	467-468	2
β-strand	470	1	1
β-strand	474-478	5	5
β-strand	492	1	6
β-strand	498	1	6
β-strand	499-503	5	1
α-helix	505-507	3
β-strand	510-512	3	3
β-strand	516-520	5	5
α-helix	521-522	2
α-helix	523-526	4
β-strand	541-542	2	4
β-strand	543-552	10	1
β-strand	556-563	8	1
β-strand	567-568	2	4
α-helix	571-578	8
β-strand	579-583	5	7
β-strand	587-589	3	8
β-strand	595-601	7	7
β-strand	608-614	7	8
β-strand	620-626	7	8
β-strand	628	1	7
β-strand	634	1	7
β-strand	637-641	5	7
α-helix	642-645	4
β-strand	654-662	9	8
β-strand	666-667	2	8
α-helix	668-670	3
β-strand	671-676	6	8

Chains M and O: 7 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	9
β-strand	404	1	10
β-strand	409	1	10
β-strand	410-414	5	11
α-helix	415-417	3
β-strand	419	1	9
α-helix	422	1
β-strand	423-424	2	12
α-helix	428-429	2
β-strand	442-445	4	11
β-strand	454-462	9	9
β-strand	470	1	9
β-strand	474-478	5	12
β-strand	491-492	2	9
β-strand	498-503	6	9
α-helix	505-507	3
β-strand	510-512	3	11
β-strand	516-520	5	12
α-helix	523-527	5
β-strand	541-551	11	9
α-helix	556	1
β-strand	557-563	7	9
β-strand	567-568	2	9
β-strand	579-583	5	13
β-strand	589	1	14
β-strand	595-601	7	13
β-strand	608-614	7	15
β-strand	620-626	7	15
β-strand	627-628	2	13
β-strand	637-641	5	13
α-helix	642-645	4
β-strand	654-662	9	15
β-strand	666-667	2	15
β-strand	671-675	5	15
β-strand	676	1	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(apaptpgpgpgpgpapcptptptpcpcp*a)-3'	A, C	DNA	15
5'-d(tptptpgpgpapapapgptpcpcpcpcp*a)-3'	B, D	DNA	15
Nuclear factor of activated T-cells, cytoplasmic 2	L, M, N, O	protein	286	Homo sapiens	Q13469 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1P7H_1 5'-D(*AP*AP*TP*GP*GP*GP*GP*AP*CP*TP*TP*TP*CP*CP*A)-3' (chains A, C)
AATGGGGACTTTCCA

Sequence of entity 2 (B, D), FASTA

>1P7H_2 5'-D(*TP*TP*TP*GP*GP*AP*AP*AP*GP*TP*CP*CP*CP*CP*A)-3' (chains B, D)
TTTGGAAAGTCCCCA

Sequence of entity 3 (L, M, N, O), FASTA

>1P7H_3 Nuclear factor of activated T-cells, cytoplasmic 2 (chains L, M, N, O)
SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENK
PLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQR
SAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDK
SQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Primary citation

Structure of NFAT1 bound as a dimer to the HIV-1 LTR kappa B element. Giffin, M.J., Stroud, J.C., Bates, D.L. et al. Nat Struct Biol (2003) 10:800-806. DOI 10.1038/nsb981 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 1P7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.