1PVH: Leukemia inhibitory factor

Crystal structure of leukemia inhibitory factor in complex with gp130. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Oct 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,026
Mol. weight: 83.69 kDa
Released: 14 Oct 2003

Explore 1PVH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PVH contains 33 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	103-107	5
β-strand	108-113	6	1
β-strand	114-115	2	2
α-helix	119-120	2
β-strand	121-125	5	1
β-strand	135-141	7	3
β-strand	146	1	3
α-helix	147-149	3
β-strand	150-151	2	3
α-helix	152-153	2
β-strand	159-161	3	1
α-helix	165-166	2
β-strand	172-180	9	3
β-strand	183-186	4	3
β-strand	190-192	3	3
α-helix	194-197	4
β-strand	198-199	2	2
α-helix	200-203	4
β-strand	204-209	6	4
β-strand	217-223	7	4
α-helix	226-229	4
β-strand	233-241	9	5
β-strand	248-249	2	5
α-helix	252-255	4
β-strand	261-265	5	4
α-helix	267-268	2
β-strand	272-281	10	5
α-helix	288-291	4
β-strand	295-298	4	5

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	22-48	27
α-helix	56-59	4
α-helix	76-104	29
α-helix	109-135	27
α-helix	155-177	23

Chain C: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	103-107	5
β-strand	108-113	6	6
β-strand	114-115	2	7
α-helix	119-120	2
β-strand	121-125	5	6
β-strand	135-142	8	8
β-strand	145-146	2	8
α-helix	147-149	3
β-strand	150-151	2	8
α-helix	152-153	2
β-strand	159-161	3	6
α-helix	165-166	2
β-strand	172-180	9	8
β-strand	183-186	4	8
β-strand	190-192	3	8
α-helix	194-197	4
β-strand	198-199	2	7
α-helix	200-203	4
β-strand	204-209	6	9
β-strand	217-223	7	9
α-helix	226-229	4
β-strand	233-241	9	10
β-strand	248-249	2	10
α-helix	252-255	4
β-strand	261-265	5	9
α-helix	267-268	2
β-strand	272-281	10	10
α-helix	288-291	4
β-strand	295-298	4	10

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	22-48	27
α-helix	56-59	4
α-helix	76-104	29
α-helix	109-135	27
α-helix	155-178	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6 receptor beta chain	A, C	protein	201	Homo sapiens	P40189 (AlphaFold model)
Leukemia inhibitory factor	B, D	protein	169	Homo sapiens	P15018 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1PVH_1 Interleukin-6 receptor beta chain (chains A, C)
GLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSC
TVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKL
TWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCM
KEDGKGYWSDWSEEASGITYE

Sequence of entity 2 (B, D), FASTA

>1PVH_2 Leukemia inhibitory factor (chains B, D)
CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFH
ANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLC
RLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Primary citation

Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130. Boulanger, M.J., Bankovich, A.J., Kortemme, T. et al. Mol Cell (2003) 12:577-589. DOI 10.1016/S1097-2765(03)00365-4 · PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5I 1.9 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
1BQU 2.0 Å, Cytokyne-binding region of GP130
1I1R 2.4 Å, Crystal structure of a cytokine/receptor complex
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
3L5H 3.6 Å, Crystal structure of the full ectodomain of human gp130: New insights into the molecular…

Browse structure collections

About this viewer

MolViewer shows 1PVH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.