Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 Jun 2005.
Explore 1Z19 in 3D Show helices and sheets RCSB PDB PDBe
1Z19 contains 39 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 75 | 1 | 1 |
| α-helix | 76-89 | 14 | |
| α-helix | 94-110 | 17 | |
| β-strand | 115 | 1 | 1 |
| α-helix | 116-118 | 3 | |
| α-helix | 121-133 | 13 | |
| α-helix | 137-156 | 20 | |
| α-helix | 169-172 | 4 | |
| α-helix | 177-179 | 3 | |
| α-helix | 182-191 | 10 | |
| α-helix | 192-194 | 3 | |
| α-helix | 197-208 | 12 | |
| α-helix | 213-216 | 4 | |
| β-strand | 220 | 1 | 2 |
| α-helix | 221-223 | 3 | |
| β-strand | 224-225 | 2 | 3 |
| β-strand | 228-232 | 5 | 3 |
| β-strand | 239-243 | 5 | 3 |
| β-strand | 247-248 | 2 | 4 |
| β-strand | 253-254 | 2 | 4 |
| α-helix | 255-261 | 7 | |
| α-helix | 262-266 | 5 | |
| β-strand | 270 | 1 | 2 |
| α-helix | 279-281 | 3 | |
| α-helix | 282-295 | 14 | |
| α-helix | 304-305 | 2 | |
| α-helix | 307-309 | 3 | |
| α-helix | 310-321 | 12 | |
| α-helix | 324-331 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 75 | 1 | 5 |
| α-helix | 76-87 | 12 | |
| α-helix | 94-110 | 17 | |
| β-strand | 115 | 1 | 5 |
| α-helix | 116-118 | 3 | |
| α-helix | 121-133 | 13 | |
| α-helix | 137-156 | 20 | |
| α-helix | 170-172 | 3 | |
| β-strand | 177 | 1 | 6 |
| α-helix | 178-179 | 2 | |
| α-helix | 182-191 | 10 | |
| α-helix | 192-194 | 3 | |
| α-helix | 198-209 | 12 | |
| α-helix | 213-216 | 4 | |
| β-strand | 220 | 1 | 7 |
| α-helix | 221-223 | 3 | |
| β-strand | 224-225 | 2 | 8 |
| β-strand | 228-232 | 5 | 8 |
| β-strand | 239-243 | 5 | 8 |
| β-strand | 247-248 | 2 | 9 |
| β-strand | 253-254 | 2 | 9 |
| α-helix | 255-265 | 11 | |
| β-strand | 270 | 1 | 7 |
| α-helix | 282-296 | 15 | |
| β-strand | 303 | 1 | 6 |
| α-helix | 304-305 | 2 | |
| α-helix | 307-309 | 3 | |
| α-helix | 310-321 | 12 | |
| α-helix | 324-330 | 7 | |
| α-helix | 336-342 | 7 | |
| β-strand | 351-352 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*cp*tp*cp*gp*tp*tp*cp*ap*gp*cp*tp*tp*tp*tp*tp*t)-3' | C | DNA | 16 | ||
| 5'-d(p*tp*tp*tp*ap*tp*ap*cp*tp*ap*ap*gp*tp*tp*gp*gp*cp*ap*tp*tp*a)-3' | D | DNA | 20 | ||
| 33-MER | E | DNA | 33 | ||
| Integrase | A, B | protein | 283 | Enterobacteria phage lambda | P03700 |
>1Z19_1 5'-D(*CP*TP*CP*GP*TP*TP*CP*AP*GP*CP*TP*TP*TP*TP*TP*T)-3' (chains C) CTCGTTCAGCTTTTTT
>1Z19_2 5'-D(P*TP*TP*TP*AP*TP*AP*CP*TP*AP*AP*GP*TP*TP*GP*GP*CP*AP*TP*TP*A)-3' (chains D) TTTATACTAAGTTGGCATTA
>1Z19_3 33-MER (chains E) TAATGCCAACTTAGTATAAAAAAGCTGAACGAG
>1Z19_4 Integrase (chains A, B) MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYID EGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSKVRRSRLTADEYLKIYQAAE SSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTGVKIAIPTALHIDALGI SMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFEGDPPTFHELRSL SARLYEKQISDKFAQHLLGHKSDTMASQYRDDRGREWDKIEIK
A structural basis for allosteric control of DNA recombination by lambda integrase. Biswas, T., Aihara, H., Radman-Livaja, M. et al. Nature (2005) 435:1059-1066. DOI 10.1038/nature03657 · PubMed
Other PDB entries of the same protein (UniProt P03700), best resolution first:
MolViewer shows 1Z19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.