2AS5: PDB entry 2AS5

Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA. Determined by X-ray diffraction at 2.7 Å resolution. Released 8 Aug 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,821
Mol. weight: 113.02 kDa
Ligands: MG
Released: 8 Aug 2006

Explore 2AS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AS5 contains 22 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains F and G: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	509-517	9
β-strand	525	1	17
α-helix	527-537	11
α-helix	539-541	3
α-helix	545-558	14
β-strand	562-567	6	17
β-strand	570-575	6	17
α-helix	577-580	4

Chain M: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	404-405	2	10
β-strand	408-409	2	10
β-strand	419	1	11
β-strand	423-424	2	12
β-strand	432	1	12
β-strand	443-444	2	13
β-strand	454-462	9	11
β-strand	470	1	11
β-strand	474-478	5	12
β-strand	489-493	5	14
β-strand	496-500	5	14
β-strand	501-503	3	11
α-helix	505-507	3
β-strand	510-511	2	13
β-strand	516-520	5	12
α-helix	521-522	2
α-helix	523-527	5
β-strand	541-552	12	11
β-strand	556-568	13	11
α-helix	572-574	3
β-strand	579-583	5	15
β-strand	587-589	3	16
β-strand	595-601	7	15
β-strand	608-614	7	16
β-strand	620-624	5	16
β-strand	627-628	2	15
β-strand	637-641	5	15
β-strand	654-661	8	16
β-strand	667	1	16
α-helix	669-670	2
β-strand	671-676	6	16
α-helix	677	1

Chain N: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	404-405	2	1
β-strand	408-409	2	1
β-strand	411	1	2
β-strand	419	1	3
β-strand	423-424	2	4
β-strand	432	1	4
β-strand	443-444	2	2
β-strand	454-462	9	3
β-strand	470	1	3
β-strand	474-478	5	4
β-strand	489-490	2	5
β-strand	493	1	6
β-strand	496	1	6
β-strand	499-500	2	5
β-strand	501-503	3	3
α-helix	505-507	3
β-strand	510-511	2	2
β-strand	516-520	5	4
α-helix	523-527	5
β-strand	541-552	12	3
β-strand	556-568	13	3
α-helix	572-575	4
β-strand	579-583	5	7
β-strand	587-589	3	8
β-strand	595-601	7	7
β-strand	608-614	7	9
β-strand	620-624	5	9
β-strand	627-628	2	7
β-strand	637-641	5	7
α-helix	643-645	3
β-strand	656-661	6	9
β-strand	667	1	9
α-helix	669-670	2
β-strand	671-673	3	9
β-strand	674-676	3	8
α-helix	677	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tptpapgpgpapapapaptptptpgptptptpcpaptpapgp*)-3'	A, C	DNA	21
5'-d(apapcptpaptpgpapapapcpapapaptptptptpcpcptp*)-3'	B, D	DNA	21
Nuclear factor of activated T-cells, cytoplasmic 2	M, N	protein	287	Homo sapiens	Q13469 (AlphaFold model)
Forkhead box protein P2	F, G	protein	93	Homo sapiens	O15409 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2AS5_1 5'-D(TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*CP*AP*TP*AP*GP*)-3' (chains A, C)
TTAGGAAAATTTGTTTCATAG

Sequence of entity 2 (B, D), FASTA

>2AS5_2 5'-D(AP*AP*CP*TP*AP*TP*GP*AP*AP*AP*CP*AP*AP*AP*TP*TP*TP*TP*CP*CP*TP*)-3' (chains B, D)
AACTATGAAACAAATTTTCCT

Sequence of entity 3 (M, N), FASTA

>2AS5_3 Nuclear factor of activated T-cells, cytoplasmic 2 (chains M, N)
ASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMEN
KPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRA
TIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQ
RSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKD
KSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Sequence of entity 4 (F, G), FASTA

>2AS5_4 Forkhead box protein P2 (chains F, G)
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKC
FVRVENVKGAVWTVDEVEYQKRRSQKITGSPTL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

FOXP3 Controls Regulatory T Cell Function through Cooperation with NFAT. Wu, Y., Borde, M., Heissmeyer, V. et al. Cell (2006) 126:375-387. DOI 10.1016/j.cell.2006.05.042 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 2AS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.