4M9P: Human filamin A Ig-like domains 3-5

Crystal structure of the human filamin A Ig-like domains 3-5. Determined by X-ray diffraction at 1.72 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,391
Mol. weight: 31.02 kDa
Released: 5 Feb 2014

Explore 4M9P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M9P contains 12 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	480-482	3
β-strand	484-486	3	1
α-helix	488-490	3
β-strand	496	1	2
β-strand	501-506	6	1
β-strand	515-521	7	3
β-strand	524-525	2	3
β-strand	529-534	6	1
β-strand	537-542	6	1
β-strand	548-556	9	3
β-strand	559-560	2	3
α-helix	564	1
β-strand	566-570	5	3
β-strand	571	1	2
β-strand	579-582	4	4
α-helix	584-586	3
β-strand	588-590	3	5
β-strand	595-601	7	4
β-strand	609-614	6	5
α-helix	618-619	2
β-strand	620-625	6	4
β-strand	630-636	7	4
β-strand	641-649	9	5
β-strand	652-653	2	5
α-helix	654	1
α-helix	657	1
β-strand	659-664	6	5
α-helix	665-667	3
α-helix	672-674	3
β-strand	676-678	3	6
α-helix	680-682	3
β-strand	688	1	7
β-strand	693-698	6	6
β-strand	707-712	6	8
β-strand	718	1	8
β-strand	721-725	5	6
β-strand	730-735	6	6
β-strand	742-749	8	8
β-strand	752-753	2	8
α-helix	754	1
α-helix	757	1
β-strand	759-762	4	8
β-strand	764	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A	protein	291	Homo sapiens	P21333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4M9P_1 Filamin-A (chains A)
SMCNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGD
GVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSA
DFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIR
LSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNE
GCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAG

Primary citation

A Novel Structural Unit in the N-terminal Region of Filamins. Sethi, R., Seppala, J., Tossavainen, H. et al. J Biol Chem (2014) 289:8588-8598. DOI 10.1074/jbc.M113.537456 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 4M9P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.